KEGG   Klebsiella michiganensis HKOPL1: J415_02515Help
Entry
J415_02515        CDS       T03188                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
koy  Klebsiella michiganensis HKOPL1
Brite
Enzymes [BR:koy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     J415_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHW86069
LinkDB All DBs
Position
complement(563156..563776)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPALPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFASLSAEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgcctgccctgccgtacgcttatgacgccctggaaccgcattttgac
aagcagacgatggaaatccatcacactaaacaccaccagacctacgtaaataacgctaac
gcagcgctggaaagcctgcctgaattcgcgagcctgtccgcagaagagctgattaccaaa
ctggatcagctgccggcagacaaaaaaaccgtgttgcgtaacaacgcaggcggccacgct
aaccacagcctgttctggaaaggcctgaaaaccggtaccaccctgcagggcgacctgaaa
gcggctatcgagcgtgatttcggttccgttgacaacttcaaagcggaatttgaaaaagcg
gcggcgacccgtttcggctccggctgggcgtggctggtgctgaaaggcgacaagctggcg
gtggtttctaccgctaaccaggactccccgctgatgggcgaagcgatctccggcgcttcc
ggcttcccgattatcggcctggacgtgtgggaacacgcttactacctgaaattccagaac
cgccgcccggactacatcaaagcgttctgggacgtggtgaactgggacgaagccgcagcg
cgttttgccgccaaaaaataa

DBGET integrated database retrieval system