KEGG   Klebsiella michiganensis HKOPL1: J415_04885Help
Entry
J415_04885        CDS       T03188                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00250  Alanine, aspartate and glutamate metabolism
koy00410  beta-Alanine metabolism
koy00640  Propanoate metabolism
koy00650  Butanoate metabolism
koy01100  Metabolic pathways
koy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    J415_04885
   00650 Butanoate metabolism
    J415_04885
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    J415_04885
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    J415_04885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:koy01007]
    J415_04885
Enzymes [BR:koy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     J415_04885
Amino acid related enzymes [BR:koy01007]
 Aminotransferase (transaminase)
  Class III
   J415_04885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHW86532
LinkDB All DBs
Position
1069324..1070589
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCSYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVTLAERINELAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGITTA
DAMKSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPPEFMQALRALCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAERLGSHLKEVLNQARQSCPAIADVRGQGSMVAVEFND
PQTGEPSAEITRQIQQQAQENGLLLLSCGVYGNVIRFLYPLTILDAQFTKALDILARVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcagcgtcgccagcaggcgactccgcgcggcgtaggggtg
atgtgcagctactttgttgagaaagcggagaacgctacgctgtgggatattgaagggaat
gaggtgatcgatttcgccgccggcatcgcggtgctgaataccggccatcgccaccccaaa
atcgttgccgccgttgaacagcagctgcaggcctttacccacacggcttaccagattgtc
ccgtacgaaagctatgtcacgctggccgagcggattaacgaactggcgccgattgacggt
ccggcaaaaacggcgttctttaccaccggggcggaagccgttgaaaacgcggtgaaaatc
gcgcgcgcttataccggtcgtccggggttgattaccttcggcggcggcttccacggccgt
acgtttatgaccatggcgctgaccggcaaagtggcgccttacaagattggtttcggcccg
ttcccgggctcggtttatcacgccgtctaccctaacgccgcccatggcattaccaccgcc
gacgcgatgaagagcctggagcgcattttcaaagcggatatcgcggccgatcaggtggcg
gcgattgtgctggagccgattcagggggaaggcggctttaacgttgccccgcctgagttt
atgcaggcgctgcgcgcgctgtgcgatacccacggcattctgctgattgccgatgaagta
caaaccggctttgcgcgcaccggcaagctatttgcgatgcagcactatgatgtgaagcct
gacctgatgacgatggccaaaagcctggccggcggtttcccgctctccggcgtggtaggt
cgcgccgaggtgatggatgcgcctgcgccgggcggtctgggcggcacctatgccggtaac
ccgctggcggtcgcggcggcgcacgcggtgctggacgtgattgaagaagaacagctgtgc
cagcgcgctgagcgcttaggcagccatctgaaagaggtgctgaatcaggcgcgtcaaagc
tgcccggcgattgctgacgtacgcggccaggggtcgatggtggcggtagagtttaacgat
ccgcaaaccggcgagccgtcggcggagatcacccgtcaaatccagcaacaagcccaggag
aacggcctgctgctgctgagctgcggcgtctatggcaacgtcattcgcttcctctatccg
ttaacgattctggatgcgcagtttacgaaagcgctggatattctggcccgcgtgctgaag
ggctag

DBGET integrated database retrieval system