KEGG   Klebsiella michiganensis HKOPL1: J415_05050Help
Entry
J415_05050        CDS       T03188                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00564  Glycerophospholipid metabolism
koy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    J415_05050 (glpD)
Enzymes [BR:koy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     J415_05050 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored FAD_binding_2 3HCDH_N NAD_binding_8 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AHW86565
LinkDB All DBs
Position
complement(1110044..1111552)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEASDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGTESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWIVEAEDIDSGEKFTWQARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDDNEVNYLLNVYNAHF
KKPLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDDNGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGSDRDDYAAKLRRRFSFISESMARHYART
YGSNSELILDKATSLDDLGEHFGHEFFEAELRYLVEHEWVRSLDDAIWRRTKQGMWLNDE
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgatagggggaggcatcaacggtgccggtatcgcggca
gacgccgcagggcgtggtttatccgtactgatgctggaggcaagcgaccttgcctgcgcc
acatccagcgccagctcaaagctgattcacggcgggctgcgctaccttgaacactatgag
ttccgtctggtgagcgaagcgctggccgaacgcgaagtgttgttgaaaatggccccgcat
atcgccttcccgatgcgctttcgtttaccgcatcgcccgcatctgcgtccggcgtggatg
atccgcattggcctgtttatgtacgatcatctgggcaagcgcaccagcttacccggctca
accgggttgcgttttggcacagaatcggtacttaaacctgaaatcgtgcgcggtttcgaa
tattccgactgctgggttgacgatgcgcgtctggtgctggccaatgcccagatggttgtg
cgtaaaggcggggaagtgcgcacgcggacccgcgccatctcggcaaaacgtgaaaacggt
ttgtggattgtcgaagccgaagatattgatagcggcgagaagtttacctggcaggcgcgc
ggtctggttaacgccaccggcccgtgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccgtacggtattcgcttgatcaagggcagccatatcgtggtgccgcgcgtgcac
acgcagaaacaggcctacatcctgcaaaatgaagataaacgcattgtgtttgtgatcccg
tggatggatgaattttccatcatcggcaccaccgacgtggagtataaaggcgatccgaaa
gcggtagcgatcgacgacaacgaagtgaactacctgctgaacgtctataacgcccacttt
aaaaagcctctcacgcgggacgatatcgtctggacctactccggcgtgcgcccgctgtgc
gacgatgaatccgactcgccgcaggcgatcacccgcgattacactcttgatatccatgat
gataacgggcaggcgccgctgctgtcggtctttggcggcaagctgaccacctatcgcaag
ctggccgagcatgcgctggagaaactgacgccttactacaaaggcatcggcccggcatgg
accaaaaccgcggtgctgcccggcggcgatatcggcagcgaccgtgacgactacgcggcg
aaactgcgccgccgcttttcgtttatcagcgaatcgatggcccgccattacgcccgcacc
tacggcagcaacagcgagctaatccttgataaggcgacctcactggacgatctgggtgag
catttcggccatgagttttttgaagccgaactgcgctatctggttgagcacgaatgggtt
cgttcgctggatgacgcgatctggcgtcgcactaaacaaggtatgtggctgaatgacgag
cagcaggcgcgcatcagcgagtggctggcgcagcacgcgggaaagtctgagctgtcgctg
gcgtcgtaa

DBGET integrated database retrieval system