KEGG   Klebsiella michiganensis HKOPL1: J415_05150Help
Entry
J415_05150        CDS       T03188                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
koy01100  Metabolic pathways
koy01110  Biosynthesis of secondary metabolites
koy01130  Biosynthesis of antibiotics
koy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    J415_05150 (aroK)
Enzymes [BR:koy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     J415_05150 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 TsaE ABC_tran APS_kinase AAA_7 AAA_5 AAA_17 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_2 AAA_28 AAA_25 AAA_29 RsgA_GTPase His_biosynth PduV-EutP AAA_24 Mg_chelatase MMR_HSR1 IstB_IS21 GTP_EFTU AAA_14
Motif
Other DBs
NCBI-ProteinID: AHW86585
LinkDB All DBs
Position
1135234..1135755
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
DREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDAPPREVLEALADERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
gggcgccagttagcccaacagctcaacatggaattttacgattccgatcaagaaattgag
aaacgcactggcgcagatgtgggttgggtctttgatgtagaaggcgaagacggcttccgc
gaccgtgaagaaaaaatcatcaatgagttgacggaaaaacagggaatcgtgctggcaacc
ggcggtggctctgtaaaatcccgtgaaacgcgtaaccgtctctccgcccgcggcgtggtg
gtctacctggaaacaactatcgaaaagcagcttgcccgtacgcagcgcgataaaaagcgt
cctttgctgcaggttgatgctccgcctcgcgaagtactggaagcgctggcggatgaacgc
aatccgctgtacgaagagattgcagatgtcactatccgcactgacgatcaaagcgcgaaa
gtggtagcaaaccagattattcatatgctggaaagcaactga

DBGET integrated database retrieval system