KEGG   Klebsiella michiganensis HKOPL1: J415_11135Help
Entry
J415_11135        CDS       T03188                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
koy  Klebsiella michiganensis HKOPL1
Brite
KEGG Orthology (KO) [BR:koy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    J415_11135
Enzymes [BR:koy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     J415_11135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AHW87744
LinkDB All DBs
Position
complement(2337982..2338611)
Genome map
AA seq 209 aa AA seqDB search
MIDFYYAPTPNGHKITLFLEEAQLAYRLIRVDIGKGEQFHPQFLAISPNNKIPAIVDHAP
ADGGGPLSLFESGAILLYLAEKTGKLLSGELRERHVTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAVPYAIERYQVETQRLYGVLNRRLGESPWLGGNHYSIADIACWPWVNAHQRQRIDL
ANYPAVHNWFERIRQRPATVEALLKTEAH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttttactacgcacccactcctaatggccacaaaatcacgttattcctcgaa
gaagcgcagctggcgtatcgcctcatccgggtggatatcggcaagggggaacagtttcat
ccgcagtttctcgcgatctcacccaacaacaagatcccggcgatcgttgaccacgctccc
gccgacggtggtggcccattaagcctgtttgaatccggcgccatcctgctctatctggct
gaaaaaacgggaaaattactgagcggcgagctccgcgagcgccacgtcaccctacagtgg
ttattctggcaggtcggcgggttggggccgatgctcggacaaaatcatcacttcaaccac
tttgctccgcaggcggtgccctacgccattgagcgctatcaggtggaaacgcagcgcctg
tatggcgtgctcaatcggcgccttggcgagagtccctggcttggcggcaatcactacagc
atcgccgatatcgcctgctggccgtgggtgaatgcccatcagcgccagcgtatcgacctt
gccaattacccggcggtgcataactggtttgaacgcattcgccagcgcccggccaccgtt
gaagcgcttctgaaaacagaagcccattaa

DBGET integrated database retrieval system