KEGG   Klebsiella michiganensis HKOPL1: J415_12280Help
Entry
J415_12280        CDS       T03188                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:koy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    J415_12280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:koy02000]
    J415_12280
Transporters [BR:koy02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    J415_12280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA_16 AAA AAA_7 CbiA MobB AAA_29 AAA_30
Motif
Other DBs
NCBI-ProteinID: AHW87963
LinkDB All DBs
Position
2591582..2592556
Genome map
AA seq 324 aa AA seqDB search
MSLLKVNQLTVMRGEDVALVDNVSLTLEAGEMLGLVGESGSGKTVTCRALMRLLPGAGLR
ITGGEVLLDGRDILSLSEGQMSAVRGREIGMIFQNPTSHLNPVMTIGEQIAESRRLHFAA
NRRQAREDALALLRQVGIPDPQNRLNSYPHEFSGGMRQRAMIAVALAPEPRLLIADEPTT
ALDVTVQMQILRLLSDLRAELGLAVIMITHDLGVVAQTCDRIAVMYGGRLCEVGGKREVL
GGPLHPYTRGLIDCQPASEGGQGRLTIIDGQPPSADHFPSGCRFHPRCRRADEACQSQPL
LRYGQDCHSHAVACHHILPARQEG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgctgaaggtaaatcagctgacggtcatgcgcggcgaggatgtcgcgctggtg
gataacgtctcgttaacgcttgaagccggggagatgcttgggctggttggcgaaagcggg
tcggggaaaaccgtgacctgccgggcgctgatgcgcctgctgccgggggccggactgcgg
attaccggcggtgaggttctgctggacggccgggatatcttgtccctcagcgaagggcaa
atgtcggcggtgcgcggccgggaaatcggcatgattttccagaacccgaccagccatctc
aatccggtgatgaccattggagagcagattgcagaaagtcgccgccttcactttgcggca
aaccgccgtcaggcgcgggaggatgcgctggccttgctgcgccaggtcggtatcccggac
ccgcagaatcggctcaatagctatccgcacgaattttccggcggcatgcgccagagggcg
atgatcgccgttgccctcgcgccggaaccccggctgctgattgctgacgaaccgaccacc
gcgctggatgtcaccgtgcagatgcagattctgcgcctgctcagcgatctgcgcgccgag
ctggggctggcggtcattatgatcacccacgatctcggggtggtggcgcaaacctgcgac
cggattgcggtgatgtacggcggcaggctgtgtgaagtgggcggcaaacgcgaagtgctt
ggcgggcccctgcatccctacacccgcgggctcattgattgtcagccggccagcgaaggc
gggcaggggaggttgacgatcatcgacggccagccgcccagcgccgaccacttcccatca
gggtgtcgctttcacccgcgctgccgccgcgccgatgaggcgtgtcagagccagccattg
ctgcgttacgggcaggattgccatagccacgcggtggcctgccatcacattttgccagca
cggcaggagggataa

DBGET integrated database retrieval system