KEGG   Klebsiella michiganensis HKOPL1: J415_17145Help
Entry
J415_17145        CDS       T03188                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00010  Glycolysis / Gluconeogenesis
koy00020  Citrate cycle (TCA cycle)
koy00620  Pyruvate metabolism
koy01100  Metabolic pathways
koy01110  Biosynthesis of secondary metabolites
koy01120  Microbial metabolism in diverse environments
koy01130  Biosynthesis of antibiotics
koy01200  Carbon metabolism
Module
koy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    J415_17145
   00020 Citrate cycle (TCA cycle)
    J415_17145
   00620 Pyruvate metabolism
    J415_17145
Enzymes [BR:koy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     J415_17145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 RnfC_N HlyD_D23 Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AHW88883
LinkDB All DBs
Position
3597362..3598891
Genome map
AA seq 509 aa AA seqDB search
MSDIRTLEMPKWGLSMEEGVLARWAIQEGDRFAKGQEICEIETSKIVNVLEAPFAGTLRR
IIARVGDTLPVGAVLALVADSSVSDAELDAFAASLAAVQPAAPVTQTTEPAVAAVAPSVV
PAPANKPAASIGQTEVPTSLQGITDPTQVNATPHALRQSARLGVDLKKVQGSGRGERISV
ADLESAIVAAGGRIASPPPPVRSGKAPRSHTDDSQVSATPLARRLANKLGINLHDCRKSG
SLGRVSRDDVLAAALLLDGLPQAGAPQATSATAFETLPMSSMRRAIAGRLQMSKQHAPHF
RLTVDLDLERLLALRKEINSEVPGVKISVNDMLVKACAMALIAVPDVNIQFDEATQSIRR
FADADISVAVALPDGLITPIVRSANSRSISDISNEIHSLITKARAGMLKPEEFQGGTFSV
SNLGMLGVRQFDAIINPPQGAILAIGAGEPRAVVRDGQIVVRHQLTVSLSCDHRVIDGAS
GAAFLQALKRLVETPTLLFIEETSYARQI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatcaggacacttgaaatgccgaagtggggcctttcaatggaggaaggcgtg
ctcgcgcggtgggccatccaggagggtgaccgcttcgccaaagggcaggaaatctgtgaa
attgagaccagcaaaatcgtcaatgttctggaggcccccttcgccggtacgctacggcgg
ataatcgcccgggtgggagataccctcccggtcggcgctgttttggcgctggtagctgac
tcttcggtaagcgatgctgaactggatgcctttgccgccagcctggccgcggtgcagcca
gcagcgcctgtcacgcagactaccgagcctgctgtagcggccgtcgcgccctccgttgta
ccggcccccgccaataagcctgcggcatccattgggcagaccgaggtacccaccagcctg
caaggcataacggatccgactcaggtgaatgccactccccatgcgttacgtcagtctgcg
cggttgggcgttgacttgaaaaaggtccagggtagcgggcgcggcgagcgtatctctgtc
gcagacctggagagcgcgatcgttgccgcaggcggccgtatcgcctctccgccgccgccc
gttcgttccggcaaagcgccgcgatcgcataccgatgatagccaggtatcggcaaccccg
ttggcgcgccgtctggccaacaaactggggatcaacctgcacgactgccgcaaaagcggt
tcactcggacgggtgagccgtgatgatgtgctggcggccgctttgctgcttgatgggcta
ccccaggccggggctccacaagccacgtcagcgacagcctttgagacgttgccgatgtcc
agcatgcggcgagcgatcgctggccgtttgcaaatgtccaagcaacatgcacctcatttc
cgtttgaccgtcgatctcgatctggagcgactcttagcattgcgtaaggaaatcaacagc
gaagtacccggcgtcaagatttcggttaacgatatgctggttaaggcctgcgccatggcg
ctgatagccgtgccggacgtcaacatacagtttgatgaggctacccagagcatccgccgt
tttgccgatgccgacatttccgtggccgttgcgctgccagacgggttaattacccctatc
gtacgttcggccaacagcaggtcgataagcgacatatcaaacgaaattcattctctgata
accaaagcccgggcgggcatgctcaagcccgaagaattccagggcggcacctttagcgtg
tcaaacctgggcatgctcggagtacggcagtttgacgccatcataaacccaccccagggc
gcgatccttgcgattggcgcaggcgagccccgagcggtagttcgcgacggacagatcgtc
gtccgccatcaactgaccgtatcgctgtcctgcgatcaccgggtcatcgatggggcgtca
ggcgcggcttttctccaggcgctcaagcggctggttgaaacaccgacgctgttgtttatc
gaggagacgagctatgcacgacaaatatga

DBGET integrated database retrieval system