KEGG   Klebsiella michiganensis HKOPL1: J415_19615Help
Entry
J415_19615        CDS       T03188                                 

Definition
(GenBank) putative oxidoreductase, Zn-dependent and NAD(P)-binding protein
Organism
koy  Klebsiella michiganensis HKOPL1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N ThiF
Motif
Other DBs
NCBI-ProteinID: AHW89352
LinkDB All DBs
Position
complement(4111768..4112811)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKTPGTMKIIAADIPVPKEHEVLIKIEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGKSVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTLEGALVEPAAVGMHAAMLANVKPGKKIVILGAGCI
GLMTLQACLCLGATDIAVVDVLEKRLAMAEQLGAKVVINGAKEDTVGRCQQFSGDMGADV
VFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDFEDVQRAFDESVNNKREIIKGVIKVNH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaacaccgggcacgatgaaaattatcgctgccgat
atcccggtacccaaagaacatgaagtgctgatcaaaattgaatacgtcggaatttgtggt
tcagatgtccacggttttgagtcggggccctttattccgccgaaagaccctaatcaggaa
attggtctgggacacgaatgtgccggtacggtggtggccgtaggcaaaagcgtgagcaaa
tttaagccgggcgaccgggtgaatattgaacccggcgtgccgtgcggccactgtcgctac
tgcctggagggaaaatacaatatctgtcccgacgtcgactttatggccacgcagccaaat
tatcgcggtgcgctaacccactatctatgccatccggagagcttcacttacaaactgccc
gataacatggacacccttgaaggcgctttggtggagcctgcggcggttggcatgcatgcc
gcaatgctggcgaacgtcaagccgggcaagaaaatcgtcatacttggcgcaggctgtatt
ggcttaatgaccctgcaggcatgcctttgcctgggggcaaccgacatcgcggtggttgat
gtgctggaaaaacgccttgccatggccgaacagctcggagccaaagtcgttatcaacggc
gcgaaagaggacaccgttgggcgctgccagcagttctccggcgatatgggggccgatgtt
gtttttgaaacggccgggtcggccatcaccgttaagcaggctccttacctggtgatgcgc
ggaggaaaaatcatgatcgtcggtacggttcccggtgattcagccatcaatttcctcaaa
attaaccgtgaggtctcgattcagaccgtcttccgctatgccaaccgctatccggtcacc
atagaagcgatctcctccgggcgtttcgatgtgaaatcgatggtgacgcatatttatgat
tttgaggatgttcagcgcgcgtttgatgaatccgttaataacaaacgcgagattattaaa
ggcgttattaaagttaaccattaa

DBGET integrated database retrieval system