KEGG   Klebsiella michiganensis HKOPL1: J415_24010
Entry
J415_24010        CDS       T03188                                 

Definition
(GenBank) PTS system mannose-specific transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00051  Fructose and mannose metabolism
koy02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    J415_24010
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    J415_24010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:koy02000]
    J415_24010
Transporters [BR:koy02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    J415_24010
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AHW90185
LinkDB
Position
complement(5029623..5030357)
AA seq 244 aa
MTTIQIILLLVIAAITGMGSVLDEGQTHRPLVACTLVGWVLGDMTTGIILGGTLEMMALG
WMNVGLAMAPDTAIASVISTILVINTNQGIGEGIAIAVALAAAGQALTIFVRTMTVFLIH
RADTYAEKGNMRGIEIMHITALGFQALRVMIPTFVVVMMSVDSVQAMLNGIPPVVTHGLQ
IGGGIIVVVGYAMVINMMSVKYLMPFFFCRFLDCGFYQFQPCWFRGNGISRCVAVYTAES
KIPA
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaccactatacaaattatattgctgctggtgattgcagccattaccgggatgggtagc
gtgctggatgaagggcaaacgcatcgtccacttgttgcctgtacgctggttggctgggta
cttggcgatatgactaccggtatcattcttggcggtacgctggaaatgatggccctcggg
tggatgaacgttgggctggcgatggcgccggataccgccatcgcctcggtgatatcgacc
attctggtgattaatacaaatcaggggattggcgaaggcatcgcgattgccgtcgcgtta
gccgctgcgggtcaggcgctgacgatttttgtcagaacgatgacggtgttcttgatccac
cgggcggatacctatgctgaaaagggcaatatgcgcggtatcgaaatcatgcatatcact
gcgcttggtttccaggcgctgcgcgtgatgattcctacctttgtggtggtcatgatgagc
gttgattcggtgcaggccatgttgaacggtattccgccagtggtgacgcatggtctgcaa
attggcggcggtattattgttgttgtgggttatgccatggtcatcaatatgatgagcgtc
aaatatcttatgccgttctttttttgccggtttcttgattgcggcttttaccagtttcaa
ccttgttggtttagggggaatgggattagtcggtgcgttgctgtatatacagctgagtcc
aaaataccagcctaa

DBGET integrated database retrieval system