KEGG   Klebsiella michiganensis HKOPL1: J415_24665Help
Entry
J415_24665        CDS       T03188                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:koy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    J415_24665
Enzymes [BR:koy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     J415_24665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434
Motif
Other DBs
NCBI-ProteinID: AHW90314
LinkDB All DBs
Position
complement(5180215..5182272)
Genome map
AA seq 685 aa AA seqDB search
MKKFAPLSPKVNALLHGADYNPEQWENYPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPQ
EGVFEFGWLDSILDKLYAAGIHVFLATPSGARPAWMSQKYPQVLRVGRDRVPALHGGRHN
HCMSSPVYRDKTLKINSLLAERYSQHPAVLGWHISNEYGGECHCSLCQERFRDWLKARYE
TLDNLNHAWWSTFWSHTYSDWSQIESPAPQGEVSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANAALPVTTNFMEYFYDYDYWQLAQVLDFISWDSYPMWHRDKDETTLACYTAMYHDM
MRSLKGGKPFVLMESTPSATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAIIDHIGHLDTRVGREVTALGEMLSQLPGVVGCRTDAKVAIIFDQQNRWALDDA
QGPRNLGMEYENTVNEHYRPFWEQGIAVDVIDADVDLSPYQLVIAPMLYMVREGFAERAE
AFVANGGHLVTTYWTGIVNESDLCHLGGFPGPLRKLLGIWAEEIDCLNDGERNLVQGLAG
NEGGLQGPYQVRHLCELIHAEMAQPLATYRDDFYAGRPAVTVNHVGKGKAWHVASRNDLA
FQRDFFTAISKELSLPRAVAADFPPGVVATARTDGETTYVFLQNYSAQQQQVTLPQGYQD
SLTGTALNAPLTLKAWDCRILSRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgcgcctttgagtccgaaggtcaatgcgctattgcatggcgccgactat
aaccccgagcagtgggagaactatcccgatattatcgataaagatattgccatgatgcag
caggcaaaatgtaatgtcatgtcggtagggatatttagctgggcgaaacttgaacctcag
gaaggcgtatttgagtttggctggttggacagtatcctggataaactctatgccgccggc
attcatgtctttctcgcgaccccaagcggcgcgcgcccggcctggatgtcgcagaaatat
cctcaggtcctgcgcgtcggtcgcgatcgggtgcctgcgctgcacggtggacgtcataac
cactgtatgtcgtcgccggtctaccgtgataaaaccctgaaaataaattccctgctggcg
gagcgctactcgcagcatcccgcggtgctgggctggcatatctccaatgaatacggagga
gagtgccactgtagcctgtgccaggagcgtttccgcgactggctgaaagcgcgctatgaa
acgctggataacctcaatcacgcctggtggagcaccttctggagccacacctacagcgac
tggtcgcagatcgaatctccggccccgcagggggaagtctccattcatggtctgaacctg
gactggcatcgcttcaataccgctcaggtgacggacttctgccgccacgaaattgcgccg
ctgaaagcggcgaatgctgcgctgccggtaacaaccaactttatggagtatttctacgat
tacgactactggcagctggcgcaggtgctggactttatctcatgggacagctaccccatg
tggcaccgtgataaagatgaaaccacgctggcctgctacaccgccatgtatcatgacatg
atgcgcagcctgaagggcggcaaaccgtttgtattaatggaatccaccccgagcgcgacc
aactggcagccgaccagtaagctgaagaaaccgggaatgcatattctctcttctctgcag
gcggtggcgcacggcgcggattcggtgcagtacttccagtggcgtaagagccgcggttcg
gttgagaagtttcatggcgcgattatcgatcatatcggtcatctggatacgcgcgtgggt
cgtgaagtgacggcgctcggcgagatgctaagccagctgccgggcgtcgtgggctgccgg
acggatgcgaaagtggcgattatcttcgaccagcaaaaccgctgggcgctggatgatgca
caggggccgcgaaatctcggcatggagtatgaaaataccgtcaacgaacattatcgtccg
ttctgggagcaggggattgcggttgatgttatcgatgctgacgttgacctgagtccttat
caactggtcattgcgccaatgctgtatatggttcgtgagggatttgccgaacgcgccgaa
gcgtttgtggctaacggtggccatttagttacaacatactggacgggtattgttaacgaa
tccgacctttgccatctcggcggtttcccgggcccgctgcgtaaactgctgggcatttgg
gcggaagagattgactgcctgaacgacggcgaacgcaacctggtacaggggctggcgggt
aatgaagggggcctgcagggaccgtatcaggtacgccatctgtgtgaactgattcatgcc
gaaatggcacagccgctggcgacctaccgcgatgatttttacgcgggacgaccggcggtt
accgtcaatcacgtgggtaaaggtaaggcctggcacgtcgcttcgcgcaacgatctggct
ttccagcgggacttcttcaccgccataagtaaagagctgtcgctgccgcgtgcggtggcg
gccgatttcccgccgggcgtggtggcgaccgcacggacggacggtgaaaccacctacgta
ttcctgcaaaactacagcgcgcagcagcagcaggtgaccttaccgcagggctatcaggac
agcctcaccggcacggcactgaacgcgccgttgaccttaaaagcgtgggattgccgtatc
ctcagtcgtcacgcgtaa

DBGET integrated database retrieval system