KEGG   Klebsiella michiganensis HKOPL1: J415_25220Help
Entry
J415_25220        CDS       T03188                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
koy  Klebsiella michiganensis HKOPL1
Pathway
koy00730  Thiamine metabolism
koy00790  Folate biosynthesis
koy01100  Metabolic pathways
koy02020  Two-component system
Module
koy_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:koy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    J415_25220
   00790 Folate biosynthesis
    J415_25220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J415_25220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:koy04147]
    J415_25220
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:koy00537]
    J415_25220
Enzymes [BR:koy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     J415_25220
Exosome [BR:koy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J415_25220
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:koy00537]
 Enzymes
  J415_25220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme PT-VENN Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: AHW90416
LinkDB All DBs
Position
complement(5292824..5294239)
Genome map
AA seq 471 aa AA seqDB search
MKLSALFIALLPLLGSPIIHAETTTAPVLENRAAQGDITTPGGARRLSGDQTEALRASLI
NKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKSYNGALGVDIHEKDHQTILELAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCASNALEKGGKGSITEQLLNARPDVTLGGGAKTFAESATAG
EWQGKTLHDQAVARGYQIVTDASSLAAISQANQDKPLLGLFAEGNMPVRWEGPKASYHGN
IDKAAVTCTPNPKRDASVPTLAQMTEKAIDLLSSNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFAKKEGNTLVIVTADHAHASQIIPADTKAPGLTQALNTKDGSVM
VMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALNLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaagcgccctgtttattgccctgctgcctctgctgggctccccgattattcac
gcagaaacaacaaccgcaccggttctggaaaatcgtgccgcgcagggcgatatcaccacg
ccgggcggcgcgcgtcgtttaagcggtgaccagaccgaggcgctgcgcgcttcgttaatc
aataaaccggctaaaaatattattttgctgattggcgacggaatgggcgattctgaaatc
accgccgcgcgaaattatgcagaaggggcgggcggcttctttaaaggcattgacgcgctg
ccgctgaccggccagtacacccattattctctggataagaaaaccggcaagccggattat
gtcaccgactccgccgcttccgcaacggcctggaccaccggcgtgaaaagctataacggc
gcgctgggcgtggatatccatgaaaaagatcatcagaccatccttgagctggcgaaagcg
gcgggcttagctaccggtaacgtctccacggcggaactgcaggacgccactcccgctgcg
ctggtggcgcatgtgacgtcgcgtaaatgctacggcccgagcgtgaccagcgaaaaatgc
gccagcaacgcgctggaaaagggcggtaaaggttcgattaccgaacagctgctgaacgcc
cgtcccgacgtaacactgggcggcggtgcgaaaaccttcgcggaaagcgcgacggccggt
gaatggcagggcaaaacgctgcacgatcaggcggtagcccgcggctaccagatcgtaacc
gacgccagctcgctggccgccattagccaggccaatcaggacaaaccgctgctcggtctc
ttcgcggaaggcaatatgccggtgcgttgggaaggcccaaaggcgtcttatcacggcaat
atcgataaggcggcggtgacctgtacgccgaacccgaaacgcgatgcatcggtgccgacg
ctggcgcagatgaccgaaaaagccatcgatctgctgagcagcaatgagaaggggttcttc
ctgcaggtggaaggcgcttctatcgataaacaggatcacgcggcgaatccgtgcggtcag
attggcgagaccgtcgatctggacgaagcggtacagaaggcgctggaatttgccaaaaaa
gagggcaataccctggttatcgtcaccgccgaccacgctcacgccagccagattatcccg
gcagataccaaagcgccgggcctgacgcaggcgctgaacaccaaagatggttcggtgatg
gtgatgagctacggcaactctgaagaagagtcgatggaacataccggcacccagctgcgt
attgccgcctacggcccgcacgcggccaacgtggtgggtttaaccgaccagacggacctg
ttctacaccatgaaagccgcacttaatctgaaataa

DBGET integrated database retrieval system