KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_00302Help
Entry
KPNJ1_00302       CDS       T03176                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00250  Alanine, aspartate and glutamate metabolism
kpa00410  beta-Alanine metabolism
kpa00640  Propanoate metabolism
kpa00650  Butanoate metabolism
kpa01100  Metabolic pathways
kpa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPNJ1_00302
   00650 Butanoate metabolism
    KPNJ1_00302
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPNJ1_00302
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPNJ1_00302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpa01007]
    KPNJ1_00302
Enzymes [BR:kpa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KPNJ1_00302
Amino acid related enzymes [BR:kpa01007]
 Aminotransferase (transaminase)
  Class III
   KPNJ1_00302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHM82708
UniProt: A0A0E1CBV8
LinkDB All DBs
Position
314158..315450
Genome map
AA seq 430 aa AA seqDB search
MTYTTGDSQVKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAV
LNTGHRHPKVVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGA
EAVENAVKIARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYP
NAAHGVTTADALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTH
GILLIADEVQTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPG
GLGGTYAGNPLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRG
SMVAVEFNDPQTGEPSPEFTRLVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKA
LDILARVLKS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgacatacacgacaggagattcgcaggtgaaaagctcagaactgaatcaacgtcgccag
caggcgacgccgcgcggcgtaggcgtaatgtgtaactactttgtcgagaaggcggaaaac
gccacgctgtgggatatcgaaggcaatgaggtgatcgatttcgccgccgggatcgccgtg
ttaaataccggtcaccgccatccgaaagtggtcgccgcggttgccgaccagctgcaggcg
ttcacccacaccgcctatcagattgtgccgtacgaaagctatgtttcgctggcggagcgt
atcaacgatctggcgccaattgacgggccggcaaaaacggctttcttcaccaccggcgcg
gaagcggtcgagaacgcggtgaaaatcgcccgcgcttacaccggtcgtccggggctgatt
accttcggcggcggtttccacggccgtacctttatgaccatggccctcaccggtaaggtc
gcgccctacaaaatcggcttcgggccattcccgggctcggtgtatcacggcgtttacccc
aatgcggcgcatggcgtgaccaccgcggatgcgctgaaaagcctggagcgcattttcaaa
gcggatattgcgccggaccaggtagcggccatcattctcgagccgatccagggggaaggc
ggctttaacgtcgcgccggccgattttatgcaggcgctgcgcgacctgtgcgatacccac
ggcattctgctgatcgccgatgaagtgcagaccggtttcgcccgcaccggcaagctgttc
gctatgcagcactatgaggtgaaaccggatctgatgacgatggcgaaaagcctcgccggc
ggtttcccgctgtcgggcgttgtcggccgcgccgaggtgatggatgcgccagccccaggc
gggctgggcggaacctatgccggtaacccgctggcggtggccgcggcgcacgcggtgctg
gatgtgattgccgaagagcagctgtgtcagcgcgctgaacagctgggtagccatctgcag
gaagtgctcaaccaggcgcgcgctacctgcccggcgatcgtagatgtccgcggccggggg
tcgatggtggcggtggagtttaacgatccgcaaacaggcgaaccgtcgccggaattcacc
cgccttgtgcaacagaaagcgcaggagaacggcctgctgctgctgagctgtggcgtctac
ggcaacgtgatccgcttcctgtatccgttgactatccccgacgcccagttctcgaaagcg
ctggatattctggcgcgcgtactgaagagctaa

DBGET integrated database retrieval system