KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_00339Help
Entry
KPNJ1_00339       CDS       T03176                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00564  Glycerophospholipid metabolism
kpa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    KPNJ1_00339
Enzymes [BR:kpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KPNJ1_00339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AHM82745
UniProt: A0A0E1C7D1
LinkDB All DBs
Position
complement(351316..352824)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWVVEAEDIDSGEKFTWKARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDDKEINYLLNVYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFPFISESLARHYART
YGSNSEWILKEASALSDLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLTAE
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgataggcggaggcatcaacggtgccggtatcgcggca
gatgccgccgggcgtggtttatccgtactgatgctggaagcgcgcgatctcgcctgcgcc
acctccagcgccagttccaaactgatccacggcgggctacgctacctcgaacactatgag
ttccgtctggtcagcgaagcgctggccgagcgtgaagtgctgttaaaaatggccccgcat
atcgccttcccgatgcgctttcgcctaccgcatcgcccgcatctgcgcccggcatggatg
atccgtatcggcttgtttatgtacgatcatctgggcaaacgcaccagcctcccgggatcc
accgggttgcgttttggcgcagaatcggtacttaaaccggaaattgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcccgcctggtgctggccaacgcgcagatggtcgtc
cgcaaaggcggcgaagtgcgtacccgcacccgcgctatctcggcgaaacgtgagaatggc
ctgtgggtggtggaagcggaagatattgatagcggtgagaagtttacctggaaggcgcgc
ggcctggtcaatgccaccggcccatgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccttacggcatccgtctgatcaagggcagccacatcgtggtgccgcgggtgcat
acccagaaacaggcttatattctgcagaacgaagataaacgcatagtatttgttattccg
tggatggatgagttctctatcatcggcacgacggacgtcgagtataagggcgatccgaaa
gcggtggccattgatgataaagagatcaactatctgctgaacgtctataacgcgcacttt
aaaaagaccctcagccgggacgatatcgtctggacctactccggcgtccgtccgctgtgc
gacgacgagtcggattcgccgcaggccattacccgcgactataccctggatattcacgat
gagaacggtcaggcgccgctgctgtccgtcttcggcggcaagctgaccacctatcgcaaa
ctggccgagcatgcactggaaaaactgaccccctattacaaagggatcggcccggcatgg
accaaaaccgcggtgctccccggcggcgatatcggcggcgaccgcgacgactacgcggca
aaactgcgccgtcgcttcccgttcatcagtgaatcactggcccgccattatgcccgcacc
tacgggagcaacagcgagtggatcctgaaggaagccagcgccctgagcgatctcggggaa
gatttcggccacgagttttatgaagccgagctgaaatatctggtggagcacgagtgggtg
cgcagcctggatgacgccatctggcgtcgtaccaaacagggcatgtggctgactgccgag
cagcaggcgcgcatcagcgaatggctggcgcagcatgcgggaaagtctgaactgtcgtta
gcgtcctga

DBGET integrated database retrieval system