KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_01782Help
Entry
KPNJ1_01782       CDS       T03176                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00010  Glycolysis / Gluconeogenesis
kpa00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNJ1_01782
   00500 Starch and sucrose metabolism
    KPNJ1_01782
Enzymes [BR:kpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KPNJ1_01782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AHM84188
UniProt: A0A0E1CG81
LinkDB All DBs
Position
1716954..1718348
Genome map
AA seq 464 aa AA seqDB search
MKIFPTDFLWGGATAANQVEGAYLEDGKGLSTSDVQPHGVFGEVVERVPGDSGIKDVAID
FYHRYPEDIALFAEMGFNCLRVSIAWTRIYPNGDDAEPNEAGLAFYDKLFDEMAKHSITP
LVTLSHYEMPWALVKNYGGWGSREVIGFFERYARTVFSRYKNKVKLWLTFNEINMSLHAP
MTGVGLPAGSSKGEVYQAIHHQLVASALAVKACHELVPEGKIGNMLLGGLMYPLSCKPED
VFETLQENRSWQFFGDVQARGAYPGYMQRYFRDNGITLTITDADREALKTTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQAREAIDDGVELMGFTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGTGTLARSKKKSFGWYKEVIASRGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattcccgacggattttttatggggcggcgcgaccgcggccaatcaggtggaa
ggtgcttatctggaagatggcaaaggcttatccacctccgatgtgcagccgcacggcgtg
ttcggcgaagtggtcgagcgcgtacccggcgacagcggcataaaagatgtggcgatcgat
ttttaccatcgctatccggaagatattgccctgtttgccgagatgggctttaactgcctg
cgagtctccatcgcctggacccgcatctaccccaacggcgacgacgccgagccgaacgaa
gccggcctcgcgttctacgacaagctgttcgacgagatggcgaagcacagcatcaccccg
ctggtgacgctgtcgcattatgaaatgccatgggcgctggtaaaaaactacggcggctgg
ggcagccgggaggtgattggcttctttgagcgctacgcccggacggtgttcagccgctat
aaaaataaggtcaaactgtggctgacctttaacgaaatcaatatgtcgctgcatgccccg
atgaccggcgtcggcctgccggccggcagcagcaaaggcgaggtgtatcaggcgattcac
caccagctggtggccagcgcgctggcggtcaaagcctgtcatgagctggtgcctgagggc
aaaatcggcaatatgctgctcggcgggctgatgtatcccctgagctgcaaaccggaggat
gtgtttgagacgctgcaggagaaccgcagctggcagttcttcggcgacgtacaggcgcgc
ggcgcgtacccgggctatatgcagcgctatttccgtgacaacggcatcacgctcaccatc
accgacgccgatcgtgaagcgctaaaaaccaccgtcgactttatctccttcagctactac
atgaccggctgcgtcaccgccgacgaggcgctgaaccagcaggcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcgagctcggagtggggctggcagatagacccgctg
ggcctgcgcacgctgctgaacgtgctgtgggatcgctaccagaagccgctgtttatcgtg
gaaaacggtctgggcgccaaagataaggtggaagccgacggcagcattaacgatgactac
cgcatcagttacctgaacgaccacctggtgcaggcgcgggaagccattgacgatggcgtt
gagctgatgggctttaccagctggggaccgattgacctggtgagcgcctcaaaggcggag
ctgtcgaagcgctacggctttatctatgtcgaccgccatgatgacggtaccggcaccctg
gcgcgcagtaagaagaagagctttggctggtataaagaggtgattgccagccgcggcgcc
agcctgaaagcctaa

DBGET integrated database retrieval system