KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_02644Help
Entry
KPNJ1_02644       CDS       T03176                                 

Definition
(GenBank) hypothetical protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00500  Starch and sucrose metabolism
kpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPNJ1_02644
Enzymes [BR:kpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KPNJ1_02644
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     KPNJ1_02644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AHM85050
UniProt: A0A0E1CDY1
LinkDB All DBs
Position
2533335..2534969
Genome map
AA seq 544 aa AA seqDB search
MRVMQREEWFHRAVIYQVDSSLFYDANGDGFGDLAGIRQKLHYIRSLGATVLWLTPFYLT
PLQDDGYDISDHLQPDPRFGTIADVIELIARARELGLRVIIELVIQHTSAQHPWFQAARR
DPRSPWRPYYLWADRPPDNDDPPMFPGVEESVWRWDEQAGQYYRHMFYHHEPDLNLAHPP
VIAEIENIITFWLQAGVSGFRLDAASHLVKQAGKGDETRGYPLLTHLRQVVQRLNPDAIL
LGEVDVAVEDYRHYFGQGDRLQMVLNFWLNKYLYLSLAQQRAAPVVKALQAMVTPPDGCC
FVNWLRNHDELDLEGIGERNKRQVIRTFAPDKSMSVYQRGVRRRLAPMLDGDTRRIALAH
AILLALPGVPVMRYGDEIGMGDDLSLPERYAVRTPMQWSAAANAGFSRAARDDLPVKPVA
SGRFRYQRINVETALRHPRSLLHRVRNMVLARTEYTEPGSLPFTLLTLKPDAVLGLLYRS
ESREVLMLANCSQQAVEVLLPPLAEGYWSPILEDKLYQDGLHGGKDARLALSGYGYRWFS
RSLS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgagagtgatgcaacgggaagagtggtttcacagagcggtcatctatcaggttgacagt
tcgctcttttatgatgccaatggcgatggttttggcgatctcgcgggcattcgccaaaag
ctacactacattcgcagcctcggagcgacggtgctctggctgactccgttctatctcact
cctctgcaggatgatggctatgatatcagcgatcatctgcagcccgatccgcggttcggc
actatcgctgacgtgattgagctgattgcccgcgcccgcgagctgggactgcgggtgatc
attgagctggtgatccagcacacctccgcgcagcacccgtggttccaggcggcgcgacgc
gatccccggtcgccgtggcggccgtattatctgtgggccgatcggccgccggataacgac
gatcctcccatgtttcccggcgttgaggagagcgtctggcgctgggacgaacaggctggg
caatattatcgccacatgttttatcaccacgagcccgacctgaatctcgcccatccgccg
gtgatcgctgaaatcgaaaacattatcaccttctggctgcaggctggggtatctggcttt
cgtctcgatgccgcgtcacatctggtcaagcaggccggaaagggcgacgagacgcgcggc
tacccgctgctgacccatctccggcaggttgtacagcgcctcaatcccgatgcgatactc
ctgggggaagtggacgtcgcggtagaagattaccgtcattatttcggccagggcgatcgg
ctgcagatggtgcttaatttttggcttaacaaatacctctacctcagcctggcgcagcag
cgcgccgcgccggtggtgaaggccctgcaggcgatggtgaccccgccggacgggtgctgc
ttcgtcaactggctgcgcaaccatgatgaactggatcttgaggggattggcgagcgcaac
aagcgccaagttatccgcacctttgcccctgataaatcgatgtccgtttaccagcgcggc
gtacgccgaagactggcgccgatgctggacggcgatacccgacgcatagcgttagcccat
gctatcctgctggcgctgcccggcgtgccggtgatgcgctatggcgacgagattggcatg
ggtgacgatctctccttaccggagcgctacgcggtcagaacgccgatgcagtggtcggcc
gcggccaacgccggcttttcccgggcggcgcgggatgatttgccggtaaaaccggtggcc
agcgggcggttccgctaccaacggatcaatgttgaaacggcgctgcgccatcccaggtcg
ctgctgcatcgggtacgcaatatggtattggcgcgcacggaatatactgaaccgggatcc
ctcccttttactctccttaccctaaagcccgacgcggtgctgggcttgctctatcgcagc
gaatcgcgggaggtactgatgctggccaactgcagccagcaggcggtagaggtcctgctc
ccgccgctggccgagggctactggagcccaattctggaagataagctctatcaggatggg
ctgcacggcgggaaagatgcgcggctggcactctccgggtatggttaccgttggttcagc
cgcagcctgagttag

DBGET integrated database retrieval system