KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_03215Help
Entry
KPNJ1_03215       CDS       T03176                                 

Definition
(GenBank) Enoyl-[acyl-carrier protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00061  Fatty acid biosynthesis
kpa00780  Biotin metabolism
kpa01100  Metabolic pathways
kpa01130  Biosynthesis of antibiotics
kpa01212  Fatty acid metabolism
Module
kpa_M00083  Fatty acid biosynthesis, elongation
kpa_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KPNJ1_03215
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KPNJ1_03215
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    KPNJ1_03215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpa01004]
    KPNJ1_03215
Enzymes [BR:kpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     KPNJ1_03215
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     KPNJ1_03215
Lipid biosynthesis proteins [BR:kpa01004]
 Fatty acid synthase
  Component type
   KPNJ1_03215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AHM85621
UniProt: A0A0E1CFZ2
LinkDB All DBs
Position
3047074..3047862
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILITGVASKLSIAYGIAQAMHREGAELAFTYQNEKLKGRVEEFAAALGSDIV
LPCDVAEDESITALFTELEKVWPKFDGFVHSIGFAPADQLDGDYVDVVTRDGFKIAHDIS
AYSFVAMAKACRGMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSNLSAGI
SGEVVHVDGGFNIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattttgatcactggcgtcgccagcaaactgtccatc
gcctacggcatcgcgcaggcaatgcaccgcgaaggcgcggaactggcattcacctatcag
aatgagaaactgaaaggtcgcgtagaagagtttgctgccgcgctgggttctgacattgtg
ctgccgtgcgacgttgctgaagatgagagcatcaccgcgctgttcaccgagctggaaaaa
gtctggccaaaattcgatggtttcgtccactcaatcggttttgccccggctgaccagtta
gacggcgactacgttgacgttgtcactcgcgacggctttaaaatcgcgcacgacatcagc
gcttacagcttcgtggcaatggccaaagcctgccgcggcatgctgaacccgggttcggct
ctgctgacgctctcctacctgggcgcagagcgcgcgatcccgaactataacgtgatgggt
ctggccaaagcctctctggaagctaacgtccgctatatggctaacgccatgggtccggaa
ggcgttcgcgtcaatgccatctctgccggtcctatccgtacgctggccgcgtccggtatt
aaagatttccgtaaaatgctggcgcactgcgaagcggtcaccccgatccgtcgcaccgtc
accattgaagatgtgggtaacagcgcagccttcctgtgctccaacctgtctgcggggatc
tccggtgaagtcgttcacgttgacggcgggttcaatatcgccgccatgaacgagctggaa
ctgaaataa

DBGET integrated database retrieval system