KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_03929Help
Entry
KPNJ1_03929       CDS       T03176                                 

Definition
(GenBank) Peroxiredoxin reductase AhpF subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPNJ1_03929
Enzymes [BR:kpa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     KPNJ1_03929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 K_oxygenase NAD_binding_8 FAD_binding_3 Glutaredoxin DAO FMO-like NAD_binding_9 AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AHM86335
UniProt: A0A0E1CHG4
LinkDB All DBs
Position
complement(3740587..3742152)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFMNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYNVDVIDSQSATKLTPAATEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLQYRDRVSGDEHHIALAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctaccttgagaagctgaccaagcct
gttgagctgattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgctgaactgtcagacaaagtcacctttaaagaagacaacacgctcgcggta
cgtaagccctcgttcctgattactaacccaggttccgaccaggggccgcgttttgcgggc
tcgccgctgggccacgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcccagtcgctgctggagcagatccgcgatattgatggcgatttcgaa
ttcgaaacctactattcgctctcctgtcataactgcccggacgtggtccaggccctgaac
ctgatggcggtgctcaacccgcgcatcaaacacacggcgattgacggcgggaccttccag
aatgagatcaccgagcgtaacgtcatgggcgtgccagcggtgttcatgaacggtcaggag
tttggtcagggacggatgacgctgactgaaatcgtcgccaaagtggataccggtgcggaa
aaacgcgcagcggaagagctgaatcagcgtgacgcttacgatgtactgatcgttggctcc
ggcccgtccggcgcggcggcggcggtctactctgcacgtaaagggattcgtaccggcctg
atgggcgaacgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatttcg
gtgccgaaaaccgaaggccagaagctggcaggcgcgctgaaagcgcacgtcaatgactat
aacgtcgacgtgatcgactcccagagtgcgaccaaactgacgccggcggcgacagagggc
ggcctgcatcagatcgaaaccgcctccggcgcggtgctcaaggcgcgtagcgtcatcatc
gccaccggggcgaaatggcgcaatatgaacgtgccgggcgaagatcagtatcgcaccaag
ggcgtgacctactgccctcactgcgatggtccgctgtttaagggcaaacgcgtagcggta
atcggcggcgggaactccggcgtggaagccgccattgacctggcgggcgtcgtagagcac
gtaaccctgctggagtttgccccagagatgaaagccgaccaggtgttgcaggataaagtc
cgcagcctgaagaatgtcgacatcattcttaatgcgcagaccacggaagtgaaaggcgat
ggcagcaaagtcaccggcctgcagtatcgtgaccgggtgagcggcgatgagcatcatatc
gcgctggcggggatcttcgtccagattggcctgctgcctaacaccacctggctggaaggc
gccgttgagcgcaaccgcatgggtgagatcatcatcgatgcgaagtgcgaaaccaacgtc
aaaggcgtgttcgccgcgggcgattgcaccaccgtgccgtacaaacagattattatcgcg
gcaggggaaggggcaaaagcgtcgctgagcgctttcgactacctgatccgcacgaaaacc
gcataa

DBGET integrated database retrieval system