KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_04374Help
Entry
KPNJ1_04374       CDS       T03176                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00730  Thiamine metabolism
kpa00790  Folate biosynthesis
kpa01100  Metabolic pathways
kpa02020  Two-component system
Module
kpa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KPNJ1_04374
   00790 Folate biosynthesis
    KPNJ1_04374
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNJ1_04374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpa04147]
    KPNJ1_04374
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpa00537]
    KPNJ1_04374
Enzymes [BR:kpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KPNJ1_04374
Exosome [BR:kpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNJ1_04374
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpa00537]
 Enzymes
  KPNJ1_04374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AHM86780
UniProt: A0A0E1CIV0
LinkDB All DBs
Position
complement(4165720..4167150)
Genome map
AA seq 476 aa AA seqDB search
MEMTKVKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEAL
RASLINKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
TATAGEWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKA
SYHGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTH
DGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagatgacaaaagtgaaattaagcgccctgtttattgccctgattcctctactgggc
tcgccggttattcatgcagaaactactgctgcgccggttctggaaaatcgcgctgcgcag
ggagatatcaccactcctggcggcgcgcgtcgtttaacaggcgatcaaaccgaagcgctg
cgcgcctcgttaatcaataagccagctaaaaacgttattttgctgattggcgatggcatg
ggtgattcggaaattaccgctgcgcgaaactatgccgagggggcgggcggtttctttaaa
ggaattgatgctctgccgttaaccgggcagtacacgcattattcgctggataaaaaaacc
gggaaaccggactacgtgaccgactcggcggcctccgccaccgcctggaccaccggcgtg
aagacttataacggcgcgctgggcgtcgatattcatgagaatgcgcatcagaccatcctc
gagctggcgaaagcggcggggctggccaccggcaacgtttccaccgccgagctgcaggac
gccacccccgcggcgttggtagcgcatgtgacatcgcgtaaatgctacggcccgacggtc
accagcgaaaaatgccccagcaatgcgctggaaaaagggggcaaaggctccattaccgaa
cagctgctgaacgcccgaccggatgtcaccctgggcggcggcgcgaagacctttgccgaa
acggcgacggcgggcgagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggc
taccagattgtgaccgacgcggcttctcttgccgccgcgacggaagccagtcaggataaa
ccgctgctgggactctttgccgatggcaatatgccggtacgctgggaagggccgaaggcg
tcttatcacggtaatatcgataagccgccggtgacctgtacgccaaacccgaagcgtgac
gcctcggtgccgacgctggcgcaaatgacggagaaagcgattgacctgctgagtcgcaac
gagaaaggtttcttcctgcaagtcgaaggcgcttccatcgataagcaggaccatgcggcc
aatccgtgcggccagatcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctg
gaattcgcgcgaaaagacggtaataccctggtgatcgtcaccgccgaccatgcgcatgcc
agccagatcatcccggcggatagcaaagccccggggctgacccaggctctgaacacgcac
gatggcgcggtgatggtgatgagctacggcaactctgaggaagagtcgatggagcacacc
ggcacccaactgcgcattgcggcctacggtccgcatgcggctaacgtcgtcggcctgacc
gatcagaccgacctgttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system