KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_04384Help
Entry
KPNJ1_04384       CDS       T03176                                 

Definition
(GenBank) Penicillin-binding protein ampH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kpa01002]
    KPNJ1_04384
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpa01011]
    KPNJ1_04384
Enzymes [BR:kpa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     KPNJ1_04384
   3.4.21  Serine endopeptidases
    3.4.21.-  
     KPNJ1_04384
Peptidases [BR:kpa01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   KPNJ1_04384
Peptidoglycan biosynthesis and degradation proteins [BR:kpa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   KPNJ1_04384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AHM86790
UniProt: A0A0E1CIV8
LinkDB All DBs
Position
4175029..4176189
Genome map
AA seq 386 aa AA seqDB search
MKRSLLIFAALCAASWTSVQAAQPTVDPVFASDVVDRYANHIYYGSGATGMALVVIDGNQ
RVFRSFGETRPGNNQHPQLDSVIRIASLSKLMTSEMLVKLLDQGVVKLNDPLSKYAPPGA
RVPDWQGKPITLVNLATHTSALPREQPGGAAHRPVFVWPTRQQRWNWLSTATLKAAPGSQ
AAYSNLAFDLLADALATAAGKPYPQLFEEQITRPLGMKDTTFTPSPDQCQRLMIPEKGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQFLSSDFYTRSQQADRMQTLIYQRNQLTRVIGMD
VPGRADALGLGWVYMKPKNGHPGIIQKTGGGGGFITYMAMNPQANVGAFVVVTRSPLTRF
NNMSDGINDLVSELSGAQPNMQTASQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgtagtttgctcatttttgctgcgctgtgcgcggcgtcgtggacctcggtgcag
gccgcacagcctaccgttgacccggttttcgcctcggatgtggtcgatcgttacgccaat
catatctactacggcagcggcgccaccggcatggcgctggtggttatcgatggcaatcag
cgtgtttttcgcagctttggcgaaacccgcccggggaataatcagcacccgcagctcgac
tcggtgatccgtatcgcctccctcagcaaactgatgaccagcgagatgctggtgaagctg
ctcgaccagggggtggtgaaactcaacgatccgctgagtaaatacgccccgccgggcgcc
cgggtgcctgactggcagggaaaaccaatcaccctggtgaatctcgcgacccataccagc
gccctgccgcgcgagcagcctggtggcgccgctcatcgtccggtgtttgtctggccgacc
cgccagcagcgctggaactggctctctaccgcgaccctgaaagccgcgccgggctcgcag
gcggcctactccaacctggccttcgatttactggcagacgcgctcgccaccgccgccggc
aaaccgtatccgcagctgtttgaagagcagatcacccggccgctggggatgaaggacacc
acctttaccccgtcaccggatcagtgccagcggctgatgatcccggaaaaaggcgccagc
ccatgcaacaacaccctggcggcgatcggcagcggcggagtctactcgacgccgggggat
atgatgcgctggatgcagcagttcctgtcatccgatttctatacccgcagccagcaggcc
gaccggatgcagacgctgatttatcagcgtaaccagctgacccgggtgattggtatggac
gtgccgggccgcgccgacgcgctgggcctcggctgggtgtatatgaagccgaagaacggc
catccggggattattcagaaaaccggcggcggcggcgggtttatcacctatatggcgatg
aatccgcaggctaacgttggcgcctttgtggtggtaacccgctcgccgttgacccgcttc
aacaatatgagcgatggcatcaacgacctggtcagcgagctgagcggcgcacagcccaac
atgcagacggccagccagtaa

DBGET integrated database retrieval system