KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_04806Help
Entry
KPNJ1_04806       CDS       T03176                                 

Definition
(GenBank) Zinc-dependent alcohol dehydrogenase
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
kpa00053  Ascorbate and aldarate metabolism
kpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    KPNJ1_04806
Enzymes [BR:kpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     KPNJ1_04806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox_2 HI0933_like Pyr_redox_3 FAD_binding_3 DapB_N Sacchrp_dh_NADP XdhC_C TrkA_N Pyr_redox adh_short FAD_binding_2 NAD_binding_8 NAD_binding_7 Shikimate_DH Egg_lysin Thi4 adh_short_C2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AHM87208
UniProt: A0A0E1CPY2
LinkDB All DBs
Position
complement(4595770..4596792)
Genome map
AA seq 340 aa AA seqDB search
MTSMNTLVCQEPKKLHWEKRQIPIPGDDEVLIKIKAVGICGTDIHAWGGNQPFFSYPRVL
GHEICGEIIGLGKNILNLKSGQQVAVIPYVACRHCPACLSGRTNCCENISVIGVHRDGGF
SEYLCVPVNNLLVVDDVDPEAVALIEPFAISAHAVRRAAIQPGDQVLVVGAGPIGLGAAA
IAKADGAQVVVADTSPARREHVAQHLGLTTLDPSDPLFTEQLSATFDGSLAQKVIDATGN
QQAMNNTVNLIRHGGSIIFVGLFKGELQFSDPEFHKKETTMMGSRNATEEDFAKVGRLMT
EGKVTARMMLTHRYDFKSLAEIYESDVINNRQLIKGVIHF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgatgaatactttagtatgtcaggaacctaaaaaattacactgggaaaaacgc
cagattcccattcccggcgatgatgaagtgctcattaaaataaaggcggtggggatttgc
gggacagatattcatgcatggggcggcaatcagcctttttttagctatccgcgtgttctt
ggtcatgaaatatgcggtgagataattgggctgggtaaaaatattcttaatttgaagagt
ggccaacaggttgctgtgattccctatgtcgcctgccgccactgcccggcctgtctgagc
ggccggacaaactgctgtgagaacatttcggtgatcggggtgcatcgcgacggcgggttt
agcgaatacctctgcgttccggtaaacaatctgctggtggtggatgatgtcgaccctgaa
gctgtagcgttgattgagccattcgccattagcgcccacgcggtgcgtcgcgcagcgatc
cagccgggagatcaggtactggtggtcggcgcgggtccgattgggctcggggcagcggcg
atcgctaaggctgacggcgcacaggtggtggtggcggataccagcccggcgcggcgcgaa
catgtggcacaacatctcggcctgaccaccctcgatccctccgatccactgtttaccgag
caactgtcggccacgtttgacggttctctggcgcagaaagtgattgacgcgacgggaaat
cagcaagcaatgaacaacaccgttaatttaatccgtcacggcggcagcatcatttttgtt
ggtctgtttaagggggagctgcagttctctgacccggaatttcataagaaagagacgacg
atgatggggagtcgtaatgcgacagaagaggattttgccaaggtcgggcggctgatgact
gaagggaaagtgaccgccaggatgatgctgacccaccgttacgacttcaaatcgctggcg
gaaatttacgaaagcgacgtgattaacaatcgtcagctgatcaaaggcgttattcatttt
tag

DBGET integrated database retrieval system