KEGG   Klebsiella pneumoniae blaNDM-1: FH42_02900
Entry
FH42_02900        CDS       T03440                                 

Definition
(GenBank) EvpB family type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpb02044]
    FH42_02900
Secretion system [BR:kpb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   FH42_02900
SSDB
Motif
Pfam: VipB VipB_2 PaaA_PaaC
Other DBs
NCBI-ProteinID: AIJ39681
UniProt: A0A086I4W3
LinkDB
Position
570851..572395
AA seq 514 aa
MSVTTENAPVQGQTTLQENRAGEGVYASLFEKINLTPASRLGDINDFLDDAALSEAPAAE
RLTAAMQVFMERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWR
GLKQLVDNTDYRQNVKTEILDVAKDDLRQDFEDAPELIQSGMYWHTYTAEYDTPGGEPIG
SVISAYEFDASPQDVALLRNISRVSAAAHMPFIGAVGPAFFLKETMEEVAAIKDIGNYFD
RAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEQVKGPDHEKYLWTS
AAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPSEVMIPETRE
FEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDN
PGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgtctgttaccacagaaaacgcccctgttcaggggcaaaccacgctgcaggaaaacagg
gcgggcgagggcgtttacgcctcgctgtttgaaaaaattaatctcaccccggcgtctcgc
ctcggggatatcaacgactttctggacgatgccgcgctctccgaggcgccggcggcggaa
cgtctcaccgcggcgatgcaggtgtttatggaacgcatccgccagtccggccagcgggtg
gaaaagctcgacaaaacgctgatcgatcaccatatcgccgagctggatttccagataagc
cgtcagctggacgcggtgatgcaccatcaggagtttcagcaggtcgaatccctgtggcgc
ggcctcaaacagctggtggacaacaccgactatcggcagaacgtcaaaacggagatcctc
gacgtcgccaaagacgatctgcgccaggactttgaggacgcgccggagcttatccagagc
ggcatgtactggcacacctataccgcggagtatgacactcccggcggcgagccgatcggc
tcggtgatctcggcctatgagttcgacgccagcccgcaggatgtggcgctgctgcgcaat
atctcccgcgtctctgcggccgcccatatgccgtttatcggcgccgtcggcccggccttc
ttcctgaaagagaccatggaagaggtggctgccattaaggatatcggcaactacttcgat
cgtgcggaatatatccgctggaaggcgtttcgcgaaactgacgatgcccgctacatcggc
ctggtgatgccgcgcgtgctgggtcgtctgccgtacggtccggacaccgtgccggtgcgc
agcttcaactatgtcgagcaggtgaagggcccggatcacgaaaaatatctctggaccagc
gcggcgttctccttcgcatctaatatggtgaagagctttgttaacaacggctggtgcgtg
caaattcgcggtccgcaggcgggcggcgcggtgaaagatttgcctatccatctgtacgat
ctgggcaccggcaaccaggtgaagatcccttccgaggtgatgatcccggaaacgcgggag
tttgagttcgccagcctgggctttatcccgctgtcgtactacaaaaatcgcgattacgcc
tgcttcttctcggccaactccgcgcagaaaccggcgctgtacgataccgccgacgccacc
gccaacagccgtatcaacgcgcgtctgccttacatcttcctgctgtcgcgcatcgcgcac
tacctgaagatgatccagcgcgaaaatatcggcaccaccaaggaccggcgtctgctggag
ctggagctgaacacctgggtgcggagcctggtgaccgaaatgaccgaccccggcgacgag
ctgcaggcctcccatccgctgcgcgatgccagcgtggtggtggaagatatcgaggataac
ccgggcttcttccgcgtgaagctgtacgcggtgccgcacttccaggtcgaggggatggac
gtcaatctgtcgctggttagccagatgccaaaggcgaaggcgtag

DBGET integrated database retrieval system