KEGG   Klebsiella pneumoniae blaNDM-1: FH42_03500
Entry
FH42_03500        CDS       T03440                                 

Definition
(GenBank) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FH42_03500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kpb01001]
    FH42_03500
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kpb02022]
    FH42_03500
Enzymes [BR:kpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     FH42_03500
Protein kinases [BR:kpb01001]
 Histidine kinases
  OmpR family
   FH42_03500
Two-component system [BR:kpb02022]
 OmpR family
  RstB-RstA
   FH42_03500
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2 R3H
Other DBs
NCBI-ProteinID: AIJ39797
UniProt: W9BGI0
LinkDB
Position
complement(701957..703258)
AA seq 433 aa
MKKLFVQFYLLLFVCFLVMTMLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPR
DWSKTLKELDLNLSFDLHIEPISKFKLSESSMQHLRAGDIVALDDQYTFIQRIPRSHYVL
SVGPVPYLYFLHEMRLLDVALMAFIAISLAFPVFIWMRPHWQDMLRIETAAQRFGEGHLS
ERIHFDSMSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSENL
TEAESQALNRDIGQLEALIEELLTYARLDRPQTELSLTTPDFPAWISDHVEDIQMVNPQR
EVALATLTHGNYGALDMRLMERVLDNLVNNALRYSSQRVAVSLTLQGSRASLLVEDDGPG
IAPEERERVFEPFVRLDPSRDRATGGCGLGLAIVHSIAQAMGGEVRCEASPLGGARFCFS
WPVYHQLPDFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaagctgttcgtgcagttctatcttctgctcttcgtctgctttctggtgatgacc
atgctggtcggtctggtctataaatttaccgcggagcgcgccggacggcagtcgcttgac
gatttgatgaaaagctcgctgtatctgatgcgcagcgagctgcgggagataccgccgcgc
gactggagcaagacccttaaagagctggacctgaatttatcgtttgatctgcacatcgag
ccgatcagcaaatttaagctgtcggaaagctcgatgcagcacctgcgcgccggcgatatc
gtcgccctcgacgatcagtacacctttattcagcgcattccccgcagccactatgtgctg
tcggtgggcccggtgccctatctctattttctgcatgagatgcgcctgctggacgtggcg
ctaatggcgtttattgctatctctctggcctttccggtgtttatctggatgcgcccgcac
tggcaggacatgctgcgcattgagacggccgcccagcgctttggcgaaggtcacctcagc
gagcgcattcacttcgacagtatgtccagcttcgagcggctcggggtggcctttaaccaa
atggccgataacattaatgcgcttattgccagcaaaaagcagctgattgacggcatcgcc
catgaactcaggacaccgctggtacgcctgcgctaccgtctggagatgagcgagaatctc
accgaggcggaatcgcaggcgctgaaccgcgatatcggtcagctggaggcgctgattgaa
gagctcctgacctacgcccgcctcgaccgcccgcagacggagctcagcctgacgactccc
gattttcccgcctggatcagcgatcacgtcgaggatatccagatggttaacccacagcgc
gaggtcgccctggcgacgctgacccacggtaactacggcgcgctggatatgcgactgatg
gagcgggtgctggataatttggtcaataacgccctgcgctacagcagccagcgggtggcg
gtcagcctgacgctgcagggttcgcgcgcttcgttgctggttgaggatgacggcccggga
atcgcccccgaggagcgcgagcgggtgtttgagccttttgtccgccttgaccccagccgg
gaccgggcgacaggaggctgcggcctcggcctggcgattgtccacagtatcgcccaggcg
atgggcggcgaggtgcgctgcgaggccagccctctcggcggcgcccgcttctgctttagc
tggccggtctatcatcagctgcctgatttcacctctgcctga

DBGET integrated database retrieval system