KEGG   Klebsiella pneumoniae blaNDM-1: FH42_15290Help
Entry
FH42_15290        CDS       T03440                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00564  Glycerophospholipid metabolism
kpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FH42_15290 (glpD)
Enzymes [BR:kpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FH42_15290 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AIJ42038
LinkDB All DBs
Position
3112994..3114502
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
SGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWVVEAEDIDSGEKFTWKARGLVNATGPWVKQFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVAIDDKEINYLLNVYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFPFISESLARHYART
YGSNSEWILKEASALSDLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLTAE
QQARISEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgataggcggaggcatcaacggtgccggtatcgcggca
gatgccgccgggcgtggtttatccgtactgatgctggaagcgcgcgatctcgcctgcgcc
acctccagcgccagttccaaactgatccacggcgggctacgctacctcgaacactatgag
ttccgtctggtcagcgaagcgctggccgagcgtgaagtgctgttaaaaatggccccgcat
atcgccttcccgatgcgctttcgcctaccgcatcgcccgcatctgcgcccggcatggatg
atccgtatcggcttgtttatgtacgatcatctgggcaaacgcaccagcctcccgggatcc
tccgggttgcgttttggcgcagaatcggtacttaaaccggaaattgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcccgcctggtgctggccaacgcgcagatggtcgtc
cgcaaaggcggcgaagtgcgtacccgcacccgcgctatctcggcgaaacgtgagaatggc
ctgtgggtggtggaagcggaagatattgatagcggtgagaagtttacctggaaggcgcgc
ggcctggtcaatgccaccggcccatgggtcaaacagttcttcgacgaagggatgcatctg
cgctcgccttacggcatccgtctgatcaagggcagccacatcgtggtgccgcgggtgcat
acccagaaacaggcttatattctgcagaacgaagataaacgcatagtgtttgttattccg
tggatggatgagttctctatcatcggcacgacggacgtcgagtataagggcgatccgaaa
gcggtggccattgatgataaagagatcaactatctgctgaacgtctataacgcgcacttt
aaaaagaccctcagccgggacgatatcgtctggacctactccggcgtccgtccgctgtgc
gacgacgagtcggattcgccgcaggccattacccgcgactataccctggatattcacgat
gagaacggtcaggcgccgctgctgtccgtcttcggcggcaagctgaccacctatcgcaaa
ctggccgagcatgcactggaaaaactgaccccctattacaaagggatcggcccggcatgg
accaaaaccgcggtgctccccggcggcgatatcggcggcgaccgcgacgactacgcggca
aaactgcgccgtcgcttcccattcatcagtgaatcactggcccgccattatgcccgcacc
tacgggagcaacagcgagtggatcctgaaggaagccagcgccctgagcgatctcggggaa
gatttcggccacgagttttatgaagccgagctgaaatatctggtggagcacgagtgggtg
cgcagcctggatgacgccatctggcgtcgaaccaaacagggtatgtggctgactgccgag
cagcaggcgcgcatcagcgaatggctggcgcagcatgcgggaaagtctgaactgtcgtta
gcgtcctga

DBGET integrated database retrieval system