KEGG   Klebsiella pneumoniae blaNDM-1: FH42_17440Help
Entry
FH42_17440        CDS       T03440                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Brite
Enzymes [BR:kpb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FH42_17440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Spore_YpjB
Motif
Other DBs
NCBI-ProteinID: AIJ42453
UniProt: A0A080SRG6
LinkDB All DBs
Position
3584143..3584763
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVENFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagctataccctgccatccctgccttacgcttacgatgctctggaaccgcacttcgac
aagcagacgatggagatccatcacactaaacaccaccagacctacgtgaacaatgccaac
gccgcgctggaaagcctgccggagttcgctaacctgtccgctgaagagctgattaccaag
ctggatcagctgccggctgacaaaaaaaccgtactgcgtaacaacgccggcggccacgcg
aaccacagcctgttctggaaaggcctgaaaaccggtaccaccctgcagggcgacctgaaa
gcggctatcgagcgcgatttcggttccgtggagaacttcaaagcggaattcgaaaaagcc
gctgctacccgtttcggctccggctgggcgtggctggtcctgaaaggtgacaaactggcc
gttgtctccaccgccaaccaggattccccgctgatgggcgaagccatttccggcgcttcc
ggcttcccgattatcggcctggacgtctgggaacacgcttactacctgaaattccagaac
cgccgcccggactacatcaaagccttctgggacgtagtgaactgggacgaagctgcagcg
cgttttgccgccaaaaaataa

DBGET integrated database retrieval system