KEGG   Klebsiella pneumoniae blaNDM-1: FH42_17580Help
Entry
FH42_17580        CDS       T03440                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00620  Pyruvate metabolism
kpb00680  Methane metabolism
kpb01100  Metabolic pathways
kpb01120  Microbial metabolism in diverse environments
kpb01200  Carbon metabolism
Module
kpb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kpb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FH42_17580
  Energy metabolism
   00680 Methane metabolism
    FH42_17580
Enzymes [BR:kpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FH42_17580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIJ42481
UniProt: A0A0C7KF02
LinkDB All DBs
Position
complement(3613453..3616104)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISANGEAASNPEVIARTLRKLKDQPNLNEE
TIKQAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYEHHQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQVLISELSMVECTDELR
ALAGAEGAQEPYRYLMKKLRSQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKSFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCKVIAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAEWRDIMAEL
SDVSCKMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELEAMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWALGSELRKLLAADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEEGKDPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaggtgctgggc
gataccatcaaggatgcattgggagaaaatattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttcacgcgccggcaacgaagctaaccgccaggagctgctgaccacgctg
cagaatttgtcaaacgacgaactgctgccggtggcccgtgccttcagccagtttctgaat
ctggccaacaccgctgagcagtaccacagcatttcggcgaatggcgaagcggccagcaat
ccggaagtcattgcgcgtaccctgagaaagctcaaagaccaacccaatctcaacgaagag
accatcaaacaagcggtggaatcgctgtctctggagctggtgttaaccgcccacccgacc
gagatcacccgccggacgctgatccataaaatggtggaagtgaacaactgccttaagcag
ttggacaacaaagatatcgctgactacgagcaccatcagctaatgcgccgtctgcgccag
ctgatcgcccagtcgtggcataccgatgaaattcgtaagcaccgcccttccccggtcgat
gaagccaaatggggcttcgcggtggtggaaaacagcctgtgggaaggggtgcctaactat
ctgcgcgagctgaacgaacagctggaagccaaccttggctatcagctgccggtggacttc
gtcccggtgcgtttcacctcgtggatgggcggcgaccgcgacggcaacccgaacgtgact
gccgacatcacccgccacgtgctgctgctcagccgctggaaagcgaccgacctgttcctc
aaagacgtgcaggtgctgatctccgagctgtcgatggtggagtgtaccgacgagctgcgc
gccctggctggcgccgagggcgctcaggaaccttaccgttatctgatgaaaaaactgcgc
tctcaactgatggagacccaggcctggctggaagcgcgtctgaaaggtcagaagctgccg
aaaccggcgggactgatcactcagaacgagcagctgtgggagccgctgtacgcctgctat
aaatcgctgcaggcctgcggcatgggcattatcgccaacggcgaactgctcgacaccctg
cgccgcgtgaagtctttcggcgtaccgctggtgcgtattgatattcgtcaggaaagcacc
cgccataccgaagcgctgggtgaaatgacccgttacctcgggatcggcgactacgaaagc
tggtcggaagccgacaaacaggctttcctgatccgcgaactgaattccaaacgtccgctg
ctgccgcgccagtgggagccaagcgaagagacgcgtgaagttctcgacacctgcaaggtg
atcgccgaggcgccgcgcggatcgatcgccgcctacgtgatctcgatggcgaaaacgccg
tccgatgtgctggcggttcatctcctgctgaaagaagccgggattggctttgctctgccg
gtggccccgctgttcgaaacgctggatgacctcaacaacgccaacgacgtcatgacccag
ctgctgaatatcgactggtaccgcggctttatccagggcaagcagatggtcatgatcggc
tactctgactccgctaaagatgccggcgtgatggccgcctcctgggcgcagtaccaggcg
caggacgcgctgatcaaaacctgcgaaaaagccggtattgaactgacgctgttccacggt
cgcggcggctctatcggccgcggcggcgcgccggcccacgccgcgctgctctcgcagccg
ccgggaagcctgaaaggcggcctgcgcgttaccgagcagggcgagatgatccgctttaag
tacggcctgccggaagtcaccatcagcagcctgtcgctgtataccagcgccattctggaa
gccaacctgctgccgccgccggagccgaaagcagaatggcgcgacatcatggccgagctg
tccgacgtgtcgtgcaagatgtatcgcggctacgtgcgtgaaaacaaagatttcgtccct
tacttccgctctgcgaccccggagcaggagctgggcaaactgccgctgggttcgcgtccg
gcaaaacgtcgtccaaccggcggcgtcgagtcgctgcgcgccattccgtggatcttcgcc
tggacccagaaccgcctgatgctgccggcctggctgggcgctggcgctgcgctgcagaag
gtagtcgaaggtggaaaacagagtgaactggaagccatgtgtcgcgactggccgttcttc
tctacccgcctcggcatgctggagatggtttactcgaaggccgacctgtggctggcggag
tactacgatcagcgcctggtgaagccggagctgtgggcgctgggttccgagctgcgcaag
ctgctggctgccgatatcaacgtcgtgctggccatcgccaacgactcccatctgatggcc
gacctgccgtggatcgccgagtctatccagctgcgtaatatctataccgacccgctgaac
gtcctgcaggcggaactgctgcaccgttcacgccaggctgaagaagagggcaaggacccg
gatccgcgcgttgaacaagcgctgatggtcaccatcgccggcgtcgccgccggtatgcgt
aacaccggttaa

DBGET integrated database retrieval system