KEGG   Klebsiella pneumoniae blaNDM-1: FH42_18065Help
Entry
FH42_18065        CDS       T03440                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00071  Fatty acid degradation
kpb00280  Valine, leucine and isoleucine degradation
kpb00281  Geraniol degradation
kpb00310  Lysine degradation
kpb00362  Benzoate degradation
kpb00380  Tryptophan metabolism
kpb00410  beta-Alanine metabolism
kpb00640  Propanoate metabolism
kpb00650  Butanoate metabolism
kpb00903  Limonene and pinene degradation
kpb00930  Caprolactam degradation
kpb01100  Metabolic pathways
kpb01110  Biosynthesis of secondary metabolites
kpb01120  Microbial metabolism in diverse environments
kpb01130  Biosynthesis of antibiotics
kpb01200  Carbon metabolism
kpb01212  Fatty acid metabolism
Module
kpb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FH42_18065 (fadB)
   00650 Butanoate metabolism
    FH42_18065 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FH42_18065 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FH42_18065 (fadB)
   00310 Lysine degradation
    FH42_18065 (fadB)
   00380 Tryptophan metabolism
    FH42_18065 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FH42_18065 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FH42_18065 (fadB)
   00281 Geraniol degradation
    FH42_18065 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FH42_18065 (fadB)
   00930 Caprolactam degradation
    FH42_18065 (fadB)
Enzymes [BR:kpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     FH42_18065 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FH42_18065 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     FH42_18065 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     FH42_18065 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AIJ42565
UniProt: A0A330XD79
LinkDB All DBs
Position
complement(3714361..3716550)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQSDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALK
IGLVDGVVAAEKLRDGALAILRQAMNGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETESKVRP
DTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDNTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKDDSKGKP
KKEEDAAVDSLLADVSQSKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKARHNEAYYPQVEPA
RPVGALKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggttcggtcaacaagcttgataccgcaaccgtagccagccttggt
catgcgctggacgtactggaaaaacaaagcgatctcaaaggtctgctgctgcgctctgaa
aaagcggcatttatcgtcggcgcggatatcaccgaattcctctcgctgttcctggtccct
gaggagcagttaagccagtggctgcattttgctaacagcgtcttcaatcgtctggaagat
ctccccgtccccactatctctgccgtcaatggctatgcgctgggcggcggttgcgaatgt
gtgctggcgaccgattaccgcctggcgacgccggacctgcgcattgggctgccggaaacc
aagctcggcattatgccgggcttcggcggttccgtgcgtctgccgcgcctgctcggcgcc
gatagcgcgctggaaattattgccgccgggaaagacgtcggcgccgatcaagcactgaaa
atcggcctggtggatggcgtggtcgctgcggaaaaactacgcgacggcgcgctggcgatc
ctacgtcaggccatgaatggcgacctggactggaaagcgaaacgtcagccgaagctggag
ccgctgaagctcagcaaaattgaagccgccatgagcttcacgattgccaaaggcatggtc
gcgcaaaccgccgggaagcattacccggcgccgatcaccgcggtcaaaaccattgaagcc
gccgcgcgtcttggtcgtgaagaagccctggtgctggaaaataaaagctttgtcccgctg
gcccataccaatgaggcccgcgcgctggttggtatcttcctgaacgaccagtacgtcaaa
gcgaaagcgaaaaagctgaccaaagatgtcgagacaccgaagcatgctgccgtcctgggc
gctggcattatgggcggcggtatcgcttaccagtcggcctggaagggcgtgccggtggtg
atgaaagacatcagcgacaaatcgctgacccttggcatgaccgaagcggcgaagctgctg
aataaacagctggaacgcggcaaaatcgacggtctgaagctggccggagtgataagcacc
attcagccaaccctggaatacagcggttttgatcgcgtcgacgtggttgttgaagcggtg
gtggaaaacccgaaagtgaagaaagccgtactagcggaaaccgagtcaaaagtgcgcccg
gataccgtgctggcgtccaacacctcaacgatccccatcagcgagctggccagcgttctg
cagcgcccggaaaacttctgcggtatgcacttctttaacccggtgcatcgcatgccgctg
gttgaagtgatccgcggcgaaaaaacctcggataataccattgccaaagtggtggcctgg
gccagcaaaatgggcaaaacgccgatcgtggtgaatgattgtcccggcttcttcgtcaac
cgggtactgttcccctacttcgccggcttcagccagctgctgcgcgacggggcggacttc
cgcaaagtcgacaaagtgatggagaaacagtttggctggccgatgggcccggcttatctg
ctggacgtggtcggcatcgataccgcgcaccatgctcaggcggtcatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgacgccatcgacgccctgtttgacgccaaccgt
ttcggccagaagaacggcctcggcttctggcgctataaagacgacagcaaaggtaagccg
aagaaagaagaagatgctgccgtcgacagcctgctggccgacgtcagccagtcgaagcgc
gatttcagcgatgaagagattatcgcccgcatgatgatcccgatggttaacgaagtcgtc
cgctgcctggaagaaggcattatcgccagcccggcggaagcggatatggcgctggtatac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggacaccatcggcagc
gcgaagtatctcgatatggcacagcaataccagcaccttggcccgctgtatgaagtgcca
gccggtctgcgtgacaaagcgcgccataacgaagcgtattatccccaggtagagccagcc
cgtccggttggcgctctgaaaacggcttaa

DBGET integrated database retrieval system