KEGG   Klebsiella pneumoniae blaNDM-1: FH42_18660Help
Entry
FH42_18660        CDS       T03440                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FH42_18660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpb02000]
    FH42_18660
Enzymes [BR:kpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FH42_18660
Transporters [BR:kpb02000]
 Other Transporters
  Pores ion channels [TC:1]
   FH42_18660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AIJ42670
UniProt: W9BQI1
LinkDB All DBs
Position
3846078..3846746
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRVLWALEELQLPYQIVRYQREKTMLAPAALKKIHPLGKSPVLEDNGY
VLAESGAILEYLQETWDSGGLLKPQGIDDKLQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGVRSLGSLLGKGIQKTWLDPQLATHARFIDDHLAARPWFAGERLSMADIQMSFPVM
ALLARGGMHDLVHIEAWRQRVEQRPAWQRAIERGGPFTLPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtacatcatcttaatcaatcacgatcgcaacgcgtactgtgggcactggaa
gagctgcagctgccttatcagatagtccgctatcagcgggagaaaacgatgctggcgccg
gcggcgctgaaaaaaatccatccgttgggcaaatcaccggtactggaagataacggctat
gtgctggcggagtccggggcgatcctcgagtatttgcaggaaacctgggacagcggcggg
ttgttgaagccgcagggaattgacgacaaactgcagtaccgcttctggctgcactatgcc
gaaggctcgctgatgccgctgctgttaatgaagctggtgttcgccagccttggcaaaccc
cctgtgccctttggcgttcgctcgctgggttcgctgctgggcaaggggatacagaaaacg
tggctcgatccgcagctggccacccatgcgcggttcattgacgaccatcttgccgcgcgg
ccatggttcgctggcgagcggctgagcatggccgatatccagatgagcttcccggtgatg
gcattgttggcgcgcggcggcatgcatgaccttgtccatatcgaggcctggcgtcagcga
gtggaacagcgaccggcctggcaacgcgccatcgagcgcggcggccccttcaccttaccc
ggcgcctga

DBGET integrated database retrieval system