KEGG   Klebsiella pneumoniae blaNDM-1: FH42_21810Help
Entry
FH42_21810        CDS       T03440                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00061  Fatty acid biosynthesis
kpb00780  Biotin metabolism
kpb01100  Metabolic pathways
kpb01212  Fatty acid metabolism
Module
kpb_M00083  Fatty acid biosynthesis, elongation
kpb_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FH42_21810
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FH42_21810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpb01004]
    FH42_21810
Enzymes [BR:kpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     FH42_21810
Lipid biosynthesis proteins [BR:kpb01004]
 Fatty acid synthase
  Component type
   FH42_21810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AIJ43270
UniProt: A0A0J2GHX2
LinkDB All DBs
Position
4518579..4519034
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcacattgaagagattctggaacttctgcctcaccgt
tacccgttcctgctggtagaccgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtttctgtaaacgagccgtttttccaggggcacttccctggtaagccgatt
ttgccgggcgtcctgattctggaagcaatggcgcaagccaccgggattctggcgttcaaa
agcgtcggaaaactggaaccaggcgagctgtactacttcgcgggtatcgatgaagcacgc
ttcaaacgcccggtagtaccaggcgatcagatgattatggaagtcactttcgagaaaacc
cgccgcggcctgacccgtttcaaaggcgttgcgctggttgacggtaaagtggtttgcgaa
gcgacgatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system