KEGG   Klebsiella pneumoniae blaNDM-1: FH42_25170Help
Entry
FH42_25170        CDS       T03440                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00030  Pentose phosphate pathway
kpb01100  Metabolic pathways
kpb01110  Biosynthesis of secondary metabolites
kpb01120  Microbial metabolism in diverse environments
kpb01130  Biosynthesis of antibiotics
kpb01200  Carbon metabolism
kpb01230  Biosynthesis of amino acids
Module
kpb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpb_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FH42_25170
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    FH42_25170
Enzymes [BR:kpb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     FH42_25170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N E1_dh DXP_synthase_N FR47
Motif
Other DBs
NCBI-ProteinID: AIJ43897
UniProt: A0A483I7Q6
LinkDB All DBs
Position
5202957..5203802
Genome map
AA seq 281 aa AA seqDB search
MKMTESQKVAAAAWRIRRYALQMGEVQGQGYIGQALGYADVLATAFSHAMTYRPEDPEWE
GRDRFLLSHGHYAIAYYAALLEAGIIPEAELETYGSDDSRLPMSGMATYTPGMEMSGGSL
GQGLSIAVGMALGLRQKQSKAWVYNSMSDGELDEGSTWEAAMSAAHYGLSNLINLVDVNK
QQADGDSRKILGFEPLQDKWAAFGWYVQRVDGNDLPAVMAAFDNAKSYSGNQPRVILCDT
LMGKGGPFLETRDKNHFIRVDADEWQKAIAVLDANKPEGVL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaccgaatcacaaaaagtcgccgcggcggcgtggcgtattcgccgttacgcc
ctgcaaatgggggaagtgcaggggcagggctatatcggccaggcgctgggctatgccgat
gtgctcgccaccgccttcagccatgccatgacctatcgcccggaagatcccgagtgggag
gggcgcgatcgcttcctgctctctcatggccattacgctatcgcttattatgccgcgctg
ctggaggcgggcattatcccggaagccgaactggaaacctacggctccgacgacagccgc
ctgccgatgtccggcatggcgacctacaccccggggatggagatgtccggcggctcgctg
gggcaggggctgtccattgccgtcggcatggcgcttgggctgcggcagaaacagagcaag
gcctgggtctacaactccatgtccgatggggagctggacgaagggtcgacctgggaggca
gcgatgtcggcggctcactatggcctgagcaacctgattaaccttgtcgatgtcaacaaa
cagcaggctgacggcgattcacgcaaaatcctcggctttgagccgctgcaggataaatgg
gccgccttcggctggtacgtacagcgcgtggacggtaacgatctgccggcggtgatggcc
gcctttgacaacgcgaaaagttattccggcaatcagccgcgggtcattttatgcgacacg
ctgatgggcaaaggggggccgttcctcgaaacccgcgataaaaaccattttattcgcgtc
gatgccgacgaatggcaaaaagcgatcgcggtgctggacgctaacaaaccggaaggagtg
ctgtaa

DBGET integrated database retrieval system