KEGG   Klebsiella pneumoniae blaNDM-1: FH42_25415Help
Entry
FH42_25415        CDS       T03440                                 

Definition
(GenBank) peptidase M15
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
kpb  Klebsiella pneumoniae blaNDM-1
Pathway
kpb00550  Peptidoglycan biosynthesis
kpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FH42_25415
Enzymes [BR:kpb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     FH42_25415
Peptidases and inhibitors [BR:kpb01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   FH42_25415
Peptidoglycan biosynthesis and degradation proteins [BR:kpb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   FH42_25415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AIJ43941
UniProt: A0A1J7E9B9
LinkDB All DBs
Position
5258348..5259550
Genome map
AA seq 400 aa AA seqDB search
MMHDAFSLRGLAAGCALLFLVAPAVQAAEQLPDAPSIDARAWILMDYASGKVLSEGNADE
KLDPASLTKIMTSYVVGQAIKAGKIKLTDMVTVGRDAWATGNPALRGSSVMFLKPGMQVS
VEDLNKGVIIQSGNDASIAIADYVAGSQDAFVSLMNGYAKKMGLTNTTFMTVHGLDAPGQ
FSTARDMALLTKALIHDVPEEYAVHKEKEFTFNKIRQPNRNRLLWSSNLNADGVKTGTTA
GAGYNLVSSATQGDMRLIAVVLGTKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDSNEAKLGAGEAGSITLPKGQLKNLKASYTLNQPQLTAPLEKGQVVGTIDFKLND
KTIEQRPLIVMESVKEGGFFSRMIDFVLMKLHGWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatgacgctttttcccttcgcggcctcgcggcaggttgcgcgctgttatttctt
gtcgcacctgcggtgcaggctgcggaacaactccccgacgccccttcaattgacgctcgc
gcctggatcctgatggactatgccagcgggaaggtgctcagcgaaggcaatgccgatgaa
aaactcgacccggccagtctgacgaagatcatgaccagctacgtggtagggcaggcaata
aaagcgggaaaaatcaaactgaccgatatggtgaccgttgggcgcgatgcctgggcgacc
ggcaacccggcgctgcgcggctcatcggtgatgttcctcaagcctggcatgcaggtttcc
gtagaagatctgaacaaaggggtcatcattcagtccggtaacgacgccagcattgcgatt
gctgactacgtagcgggcagccaggacgctttcgttagcctgatgaacggctacgccaaa
aagatggggctgaccaacaccacctttatgaccgtccacggccttgacgcgccggggcag
ttcagcaccgcccgcgatatggcgctgctgaccaaagcgctgatccacgacgtaccggaa
gagtacgcggtacataaagagaaagagttcactttcaataaaattcgccagccgaaccgc
aaccgcctgctgtggagcagcaacctcaacgccgatggcgtgaaaaccgggaccaccgcc
ggggccggctataacctcgtctcctcggccactcagggtgatatgcgtttgatcgccgtg
gtgctggggaccaaaaccgaccgcattcgctttaacgagtcagaaaaactgctgacctgg
ggcttccgcttctttgaaaccgtgacgccgattaaaccagatgccaccttcgttacccag
cgcgtgtggtttggcgatagcaatgaagcgaaactgggggctggcgaggcgggctctatc
actttgccgaagggccagctgaaaaacctgaaagccagctataccttaaatcagccgcag
cttaccgcgccgctggagaaggggcaggtggtcgggactatcgactttaagctaaatgat
aaaaccattgaacagcgtccgctgattgtcatggagtcggtaaaagagggcggcttcttc
agccggatgatcgacttcgtgctgatgaaactgcacggctggttcggcagctggttctcc
tga

DBGET integrated database retrieval system