KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_07845Help
Entry
KPNIH10_07845     CDS       T03788                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00020  Citrate cycle (TCA cycle)
kpc00190  Oxidative phosphorylation
kpc00650  Butanoate metabolism
kpc01100  Metabolic pathways
kpc01110  Biosynthesis of secondary metabolites
kpc01120  Microbial metabolism in diverse environments
kpc01130  Biosynthesis of antibiotics
kpc01200  Carbon metabolism
Module
kpc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPNIH10_07845 (sdhB)
   00650 Butanoate metabolism
    KPNIH10_07845 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KPNIH10_07845 (sdhB)
Enzymes [BR:kpc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KPNIH10_07845 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     KPNIH10_07845 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AIA35847
LinkDB All DBs
Position
1629465..1630181
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPHMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETSERLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgagttttcaatttatcgctataacccggatgttgacgacgctccgcacatg
caggattacacccttgaagcggaagaaggtcgcgacatgatgctgctggatgcgctgatc
cagctgaaagaaaaagatccgtcgctgtcgttccgccgctcctgccgtgaaggggtctgc
gggtccgatggtctgaacatgaacgggaaaaacggtttggcgtgcatcacgccaatctcc
gcgctgaatcagccgggcaagaagattgttatccgtccgctgccaggattaccggttatc
cgtgatttggtggtggacatggggcaattctatgcacaatatgagaagattaagccttac
ttgttgaataatgggcaaaatcctccggctcgcgagcatctgcagatgcctgagcagcgt
gagaaactcgacgggctgtacgagtgtattctgtgcgcctgctgttcgacctcgtgcccg
tcgttctggtggaacccggacaagttcatcggcccggctggcctgctggccgcgtatcgc
ttcctgatcgacagtcgcgataccgaaaccagcgagcgcctggacggcctgagcgatgct
ttcagcgtattccgctgtcacagcattatgaactgcgtcagtgtgtgtccgaaggggctg
aacccgacgcgcgccatcggccatattaagtcgatgctgctgcagcgcagcgcgtaa

DBGET integrated database retrieval system