KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_18500Help
Entry
KPNIH10_18500     CDS       T03788                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00071  Fatty acid degradation
kpc00280  Valine, leucine and isoleucine degradation
kpc00281  Geraniol degradation
kpc00310  Lysine degradation
kpc00362  Benzoate degradation
kpc00380  Tryptophan metabolism
kpc00410  beta-Alanine metabolism
kpc00640  Propanoate metabolism
kpc00650  Butanoate metabolism
kpc00903  Limonene and pinene degradation
kpc00930  Caprolactam degradation
kpc01100  Metabolic pathways
kpc01110  Biosynthesis of secondary metabolites
kpc01120  Microbial metabolism in diverse environments
kpc01130  Biosynthesis of antibiotics
kpc01200  Carbon metabolism
kpc01212  Fatty acid metabolism
Module
kpc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPNIH10_18500 (fadJ)
   00650 Butanoate metabolism
    KPNIH10_18500 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNIH10_18500 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPNIH10_18500 (fadJ)
   00310 Lysine degradation
    KPNIH10_18500 (fadJ)
   00380 Tryptophan metabolism
    KPNIH10_18500 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPNIH10_18500 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPNIH10_18500 (fadJ)
   00281 Geraniol degradation
    KPNIH10_18500 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPNIH10_18500 (fadJ)
   00930 Caprolactam degradation
    KPNIH10_18500 (fadJ)
Enzymes [BR:kpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KPNIH10_18500 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPNIH10_18500 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KPNIH10_18500 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AIA37869
LinkDB All DBs
Position
complement(3811820..3813964)
Genome map
AA seq 714 aa AA seqDB search
MDTVSAFKLEVCADKIAVITIDAPGEKMNTLKAEFGSQVRGLIRQLRDDKSVRGVVFISA
KADNFIAGADINMIARCRSAQEAEALARQGQQIMAEIHGLSIPVIAAIHGACLGGGLELA
LACHGRICSDDEKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMMLTGKQLRPRQAL
KAGLVDEVVPQAILLQAAVELALKGRPTSREVPVRERVLAGPLGRHLLFQFVGKQTQRKT
QGNYPAVKRILQVVENGLAHGCSSGYAEEARAFGELAMSPQSQALRSIFFASTDLKKDPG
AEAGPGPLRSVAVLGGGLMGGGIAYVTACKGGLPVRIKDIQPRGINHALKYSWDLLNKQV
RQRRLRPVERDRQMALISGTTDYQGFAHRDVVIEAVFEDLALKQRMVSEVEQYGGPQTIF
ASNTSSLPIGDIAAHASRPGQVIGLHFFSPVEKMPLVEVIPHKGTDPQTIATVVQLAKRQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLVEGEPIEVIDNALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLESAFGERFSPPANIIDAILKDDRKGRKNNRGFYLYETKGRKSKKRPDPA
VYPLLGIGRPQSRLYAQQVAERCVMMMLNEAARCFDEQIIRSARDGDIGAVFGIGFPPFL
GGPFRYMDTIGAGEVAAILQRLAAQFGPRFTPCDTLLRMAEQGTTFWPADERLT
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggatactgtttccgcttttaagcttgaggtctgtgcggacaaaatcgcggtgatcacc
attgatgccccgggtgaaaaaatgaataccctgaaagccgaatttggcagtcaggtacgg
ggattgatacgccagttacgtgacgataagtcagtgcgcggcgtagtatttatctccgcc
aaagcggataactttatcgccggcgctgatatcaacatgattgcccgctgccgcagcgcg
caggaggcggaagcgctggcgcgccagggacagcagattatggctgagatccatggcctg
tcgatcccggtgattgccgctatccacggcgcctgccttggcggcggtctggagctggcg
ctggcctgtcatggccgtatctgtagcgatgacgaaaaaacccgactcggcttgccggag
gtacagcttggcctgctgccgggttccggcgggacgcagcgtttaccgcggctgatcggg
gtcagcaccgcgctggatatgatgctcaccggcaagcagctgcggccgcggcaggcgctg
aaggccggtctggtggacgaggtggtgccgcaggcgattttactgcaggcggcggtggag
ttggcgctgaagggacgaccgaccagccgggaggtgcctgttcgtgaacgcgtactggca
gggcccctggggcgccatctgttattccagtttgtcggtaaacaaacgcagcgcaaaacg
cagggaaattacccggcggtgaagcgaatcttgcaggtcgtcgagaatggtctggcccat
ggctgcagcagcggatacgctgaagaggcgcgcgcatttggcgaactggcaatgagcccg
cagtcgcaggcgctgcgatcgatcttctttgccagtaccgatctgaaaaaagaccctggc
gccgaggcgggccccggtccgctgagaagcgttgcagtactgggcggtggcttgatgggc
ggggggatcgcctatgtgaccgcctgtaagggggggctgccggtgcggattaaagatatc
cagccgcgtggcatcaaccacgccttaaagtacagctgggatctgctgaataaacaggtt
cgtcagcgtcgactgcgcccagtggagcgcgatcgtcagatggcgctgatctccggcact
accgactatcagggctttgctcatcgcgatgtggtgatcgaggcggtatttgaagacctg
gctctcaaacagcggatggtcagcgaagtggaacaatacggcgggccgcagaccatcttt
gcgtcgaatacctcatcgttgccaatcggcgatattgccgctcacgccagccgcccgggg
caggtaatcggcctgcattttttcagtccggtggaaaaaatgccgctggttgaggtgatc
ccgcacaagggaaccgacccgcagactatcgccaccgtggtgcagctggctaaacggcag
gggaaaacgccgattgttgtcgcagataaagcggggttctatgtgaaccgtatcctcgcg
ccgtatatcaatgaagcgatgcgcctgctggtggaaggcgaaccgattgaagtcattgat
aacgcgttggttaaattcggtttcccggtggggccgattcaactgctggatgaggtgggt
atcgataccggcaccaaaattatccccgtgctggagagcgcgtttggagaacgttttagc
ccgcctgcaaacatcattgacgcgattttgaaggacgatcgcaaaggcagaaaaaataat
cgtggtttctatctttatgagacaaaagggcgtaaaagcaaaaaacggcccgacccggca
gtctatccgctgctcggcatcggccgcccgcagtcgcggctctacgcgcagcaggtggcg
gagcgctgtgtgatgatgatgcttaacgaagcggcgcgctgctttgatgagcagattatc
cggagcgcgcgcgatggcgatatcggcgccgtctttggtatagggtttccgccatttctt
ggcggcccgttccggtatatggatactatcggcgcgggtgaagttgccgcgatcctgcag
cgcctggccgcccagttcggcccacgttttacaccctgtgacactttattacgcatggct
gaacaggggaccaccttttggccagcggatgaacggctgacctaa

DBGET integrated database retrieval system