KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_24785Help
Entry
KPNIH10_24785     CDS       T03788                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Pathway
kpc00250  Alanine, aspartate and glutamate metabolism
kpc00410  beta-Alanine metabolism
kpc00640  Propanoate metabolism
kpc00650  Butanoate metabolism
kpc01100  Metabolic pathways
kpc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPNIH10_24785
   00650 Butanoate metabolism
    KPNIH10_24785
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPNIH10_24785
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPNIH10_24785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpc01007]
    KPNIH10_24785
Enzymes [BR:kpc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KPNIH10_24785
Amino acid related enzymes [BR:kpc01007]
 Aminotransferase (transaminase)
  Class III
   KPNIH10_24785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIA39067
LinkDB All DBs
Position
complement(5043088..5044353)
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRLVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgccatccgaaa
gtggtcgccgcggttgccgaccagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagctatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaagcggtcgagaacgcggtgaaaatc
gcccgcgcttacaccggtcgtccggggctgattaccttcggcggcggtttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcgccctacaaaatcggcttcgggcca
ttcccgggctcggtgtatcacggcgtttaccccaatgcggcgcatggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggaccaggtagcg
gccatcattctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgacctgtgcgatacccacggcattctgctgatcgccgatgaagtg
cagaccggtttcgcccgcaccggcaagctgttcgctatgcagcactatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgttgtcggc
cgcgccgaggtgatggatgcgccagccccaggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtgattgccgaagagcagctgtgt
cagcgcgctgaacagctgggtagccatctgcaggaagtgctcaaccaggcgcgcgctacc
tgcccggcgatcgtagatgtccgcggccgggggtcgatggtggcggtggagtttaacgat
ccgcaaacaggcgaaccgtcgccggaattcacccgccttgtgcaacagaaagcgcaggag
aacggcctgctgctgctgagctgtggcgtctacggcaacgtgatccgcttcctgtatccg
ttgactatccccgacgcccagttctcgaaagcgctggatattctggcgcgcgtactgaag
agctaa

DBGET integrated database retrieval system