KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_24820Help
Entry
KPNIH10_24820     CDS       T03788                                 

Definition
(GenBank) hypothetical protein
  KO
K08993  putative membrane protein
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
Brite
KEGG Orthology (KO) [BR:kpc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    KPNIH10_24820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1145 EutH Cytochrom_C_asm
Motif
Other DBs
NCBI-ProteinID: AIA39074
LinkDB All DBs
Position
5051183..5051458
Genome map
AA seq 91 aa AA seqDB search
MLINLGRLLMLCVWAFLLLNLFQPFPKPLNIFVNVALIFMILMHGLQLTLLKATQPKEAP
PLSRFEQIRIFIFGVFELVAWQKKLKATLKK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgctgattaatttaggccgcctgctgatgctgtgcgtctgggcctttctgttattgaat
ctgtttcagcccttcccgaagccgctgaatatctttgtcaacgtcgcgctgattttcatg
atcctgatgcacggtctgcagctgacgctgctcaaggcgacgcagccgaaagaggcgccg
ccgctgagccgctttgagcaaatccgcatttttattttcggcgtgtttgagctcgtggcc
tggcagaaaaaactgaaggcgacgctgaaaaaatag

DBGET integrated database retrieval system