KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH10: KPNIH10_25185
Entry
KPNIH10_25185     CDS       T03788                                 

Definition
(GenBank) ankyrin
Organism
kpc  Klebsiella pneumoniae subsp. pneumoniae KPNIH10
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank MLTD_N
Other DBs
NCBI-ProteinID: AIA39146
LinkDB
Position
complement(5139908..5141302)
AA seq 464 aa
MKVIKGLVLLCLMMLAGCQSEEETSQFLLACKYDAPATIAAMLDNGIDVDGQDKTGLSGL
MVAAAENRRDVVELLLKRRAKPNLQTRQGVTALMLAAARGSDTAIIGDLLQAGASVNQTS
IDKSTALMSAISDGGDIRNDYQHILAMKKPDAPVEEESTLDKIVGATAAKSLATGNRALM
TEDMALQLAPGAFKKNVDEIVALLLKHGADVKAVNASGESAFFLAVDHARSAETITTLAN
AGADTSLADKSGTTPLMLAAAGDDPDLVLALSASGVEVDQPNREGLTALQVAAGQGAPAV
IAALAQRGAKVDQLSANDLSPLMLAVKMNNKANVEALLAAGASVNLSNKAGYTAIGYSRA
GEVRQLLLAQHAELKGQAAHMAQSELQFCANAFADKLAYSDIARAVNNDTRPDIMRHQQS
CPELGELTMLLGEFTFTPAGATYLGEPVTCKVSEYRKTFEVNCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaaggtgataaaggggttggtcctactgtgcctgatgatgctcgcgggctgccagtct
gaggaagagaccagccagttcctgctggcctgtaaatacgatgcgccagcgacgatcgca
gccatgctggataacggcattgatgtggatggtcaggataaaaccggcttaagcggcctg
atggtcgctgctgcggaaaatcgacgcgatgtggtggaattgctgcttaagcgtcgggcg
aagccgaacctccagacgcgccagggcgtcacggcgctgatgctggcggcggcgcgtggc
agcgataccgcgattatcggcgatcttctccaggcgggagcgtcggtgaatcagacctcc
atcgacaagagtacggcattgatgtccgccatctccgacggcggggacatcagaaacgac
tatcagcatattctggcgatgaaaaagcccgatgcgcctgtcgaagaggagagtacgctg
gacaagatagttggcgcaacggcggcgaaatcgctggcgacgggcaatcgcgcgctgatg
accgaagacatggcgttacaactggcgcccggcgcgtttaagaagaacgtcgacgagata
gtggcgctgctcctcaagcacggcgcggacgtgaaggctgtcaacgcgtccggggaatcg
gcctttttcctcgctgtcgatcacgcgcgatcggcggaaaccatcacgacgttggccaac
gccggggcggacaccagcctggcggataaatccggcaccacaccgctgatgctggcggcg
gcgggggatgatcccgatctggtgctggcgctgtcggcctccggggtggaagtggatcag
ccgaaccgtgaaggactcacggcgctgcaggtggcggcgggtcagggggcgcctgcggtg
atcgcggcgctggcgcagcgcggcgcaaaggtggaccagctttccgccaacgatctcagc
ccgctgatgctggcggtcaaaatgaataataaagccaatgtcgaggcgctgcttgcggct
ggcgccagcgtcaacctcagcaataaggccggctatacggcgattggctacagccgggcc
ggcgaggttcgccagctgctgctggcacagcatgccgagctgaaggggcaggccgcgcat
atggcgcaaagcgaactgcagttttgtgctaatgcctttgctgacaagctggcatacagc
gacatcgcccgggcggtgaataacgatacccgcccggatattatgcgtcatcagcaatcc
tgcccggagctgggggagctgacgatgctactgggagagtttacattcaccccggcgggc
gcaacctatctcggcgagccggtgacatgtaaggtatccgagtatcgcaaaacgtttgag
gtcaactgccgctaa

DBGET integrated database retrieval system