KEGG   Kangiella profundi: CW740_00445Help
Entry
CW740_00445       CDS       T05254                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kpd  Kangiella profundi
Brite
KEGG Orthology (KO) [BR:kpd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CW740_00445 (ahpF)
Enzymes [BR:kpd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CW740_00445 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA DAO FAD_binding_2 Thi4 FAD_oxidored AlaDh_PNT_C NAD_binding_8 Lycopene_cycl NAD_binding_7 Thioredoxin_9 Thioredoxin_4 Glutaredoxin K_oxygenase 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AUD77784
UniProt: A0A2K9AFR9
LinkDB All DBs
Position
complement(87720..89330)
Genome map
AA seq 536 aa AA seqDB search
MLNNQILEALKGYTAKMQKTVTFVLQTGEHSKRNELKEFLTSFVSVSDKLQLEERDLSGQ
VRSPISFILEVDGNDTGIRFSGIPSGHEFNSLVLAVLQAAGSPVKLDDSLKKMVAKVQQE
MNFEVFISLSCHNCPDVVQALNQFALLNPNIKTEMIDGGLFQDMIKERDIQGVPSVYMNG
ELFANGKVTAAELIDKLLEKDPSIAQANSDEQMPLQDVVVIGGGPAGVGAAIYSARKGLK
VTLIADRIGGQVKDTMGIENLISVPKTTGPELSGALQQHLNDYDVTVKEHLRVTDIEQGD
IKSVTLSSGEVIDSKTLIIATGAKWRELGIPGEKENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADKVLVDQAEARDNITILRNVATKEIHSEN
GKVSAIEYQDRATEALHTQKLDGVFVQIGLVPNSKFLGDLVELSRFGEVVINEKCETSQP
GIFACGDVTTVPYKQIVVAMGEGSKASLASFEYLLANSSRLEKMYQDHQSSQSEAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgttgaataatcaaattttagaagccttaaagggctataccgccaagatgcaaaagacg
gtgactttcgttttgcaaaccggtgagcattcaaaacgtaatgaacttaaagaattccta
accagctttgtcagcgtcagcgacaaactgcaattagaagaacgtgacctgtcaggtcag
gttcgcagtccgatcagcttcattcttgaggtagacggaaacgacacaggcatccgattc
tcaggcatcccatctggccatgagtttaactctctggtgcttgctgtattacaggcagcc
ggaagtccggtcaagttggatgattccctgaaaaagatggtggccaaagtacaacaggaa
atgaattttgaggttttcatcagcctcagctgccataactgtcctgatgtggttcaggcg
ttaaatcagtttgcgctactgaatccaaacattaagacagaaatgattgatggtggcttg
ttccaggacatgatcaaagaacgcgacattcaaggtgtcccaagtgtctacatgaacggt
gagctgttcgctaacggtaaagtgactgccgcggaactgattgataagttgctggaaaaa
gatccgagcattgcccaggctaattctgacgagcaaatgcctttgcaggacgtcgttgtg
attggtggaggccctgcaggtgttggtgccgcgatttacagcgcgcgcaaaggccttaag
gttaccctgattgctgatcgcatcggtggtcaggtcaaagacaccatgggtatcgaaaat
ctgatttctgtgccaaaaacgacaggccctgaattatcgggtgctttacaacagcacctg
aatgattacgacgttactgttaaagagcatctacgtgttaccgatatcgaacaaggtgat
atcaaaagcgtgactctttcgtcaggagaagtgattgacagtaaaacgctaattatcgct
actggtgctaaatggcgtgagctaggcatccccggtgaaaaagaaaacatcggtaatgga
gttgcctactgccctcactgtgacggccctttctttaaaggcaaagatgttgccgtcatt
ggcggtggtaactcaggcatcgaagcggcacttgatttggcaggcatcgtgaagtcagtc
actgtcttcgaattcatgcccgaactgaaagccgacaaggtcctggtcgatcaggcagaa
gctcgtgacaacatcaccattctgcgcaatgtagcgacgaaagagattcattcagaaaat
ggtaaagtgtctgctatcgagtatcaggacagagcgaccgaagccttgcatacacaaaag
ttagacggtgtgtttgtgcagattggactggtgccgaacagtaagttcctgggtgaccta
gtagagttgagccgcttcggtgaggtagtgatcaacgaaaaatgcgaaacatcacagccg
ggtatctttgcctgtggagacgtaactactgtaccttataaacaaatcgtagtggcgatg
ggcgaaggatccaaagcctcactggcatcttttgaatacctgttggctaactcatcacgc
cttgaaaagatgtatcaggatcatcagtctagccaatcagaagcggcataa

DBGET integrated database retrieval system