KEGG   Kangiella profundi: CW740_09815Help
Entry
CW740_09815       CDS       T05254                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
kpd  Kangiella profundi
Pathway
kpd00061  Fatty acid biosynthesis
kpd00780  Biotin metabolism
kpd01100  Metabolic pathways
kpd01212  Fatty acid metabolism
Module
kpd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:kpd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CW740_09815
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CW740_09815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpd01004]
    CW740_09815
Enzymes [BR:kpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     CW740_09815
Lipid biosynthesis proteins [BR:kpd01004]
 Fatty acid synthase
  Component type
   CW740_09815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N CaMKII_AD KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AUD79518
UniProt: A0A2K9B3M3
LinkDB All DBs
Position
2098479..2099696
Genome map
AA seq 405 aa AA seqDB search
MKRVVITGMGIVSCLGNNVEEVAESLKQGKSGIKFKEIYKEKGLRSQVAGKPDMDIKDHI
DRKIVRFMGDAAGYAYISMQQAIEDAGLTEDQVSNIRTGLITGSGGGSQGTQVESVDIAL
ERGVKRVGPYAVPKTMGSTTSACLATPFKIKGINYSITSACATSAHCIGNAYEQIAMGKQ
DIVFAGGGEEEDWRLTLLFDAMGALSTKYNDSPETASRPYDATRDGFVISSGGGILVMEE
YEHAKARGAKIYAELTGYGATSDGYDMVAPSGEGAVRCMQQALATVKGDIDYVNTHGTST
PVGDTAELKAIKEVFGDKLPKISSTKSLAGHSLGATGVHEAIYSLIMMRDNFIAASANIT
ELDEGAAGMPIVQKREDGVELKRILSNSFGFGGTNACLVFEKYDQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtcgttattacaggcatgggtatcgtttcatgcctaggaaacaatgttgag
gaagttgccgagtctttaaagcaaggcaagtccggtatcaaattcaaagaaatctataaa
gagaaagggttacgcagccaggttgccggcaagcccgatatggacatcaaagatcatatt
gatcgtaaaattgtccgctttatgggtgacgcagcaggttacgcctatatctccatgcaa
caggctatcgaagatgcaggtttaactgaagatcaggtttccaatatccgcactggccta
atcaccggctctggcggtggctcacaaggcactcaggtcgagtcagtagatattgcgctg
gaacgcggcgtaaaacgtgttggcccttacgcagtgccaaaaaccatgggcagcactacc
tcggcctgtctggcgactccttttaaaatcaaaggcattaactacagtatcacttcagcc
tgtgctaccagcgcccactgtatcggtaacgcttatgagcaaatagccatgggcaaacag
gacatcgtattcgcaggtggtggtgaagaagaagattggcgtttgaccctgctatttgat
gccatgggcgccttatcaacaaaatacaatgactcgccagaaaccgcttcgcgtccttac
gatgcgactcgcgatggttttgtcatttcatctggcggcggcattctggtcatggaagag
tatgaacacgccaaagctcgtggtgccaagatctatgctgaattaacgggctatggtgca
acctctgatggctacgacatggtcgcaccttctggcgaaggcgctgttcgctgtatgcaa
caggcactggcaaccgttaaaggtgatatcgattacgttaacacccacggcaccagtact
ccggtcggcgacacagcagagttgaaagccatcaaagaagtgttcggtgacaaattgcca
aagatcagctcaaccaaatcactggctggtcactcattaggtgccactggcgttcacgag
gcgatctatagtctgattatgatgcgcgataattttatcgccgcttctgccaacattact
gaacttgatgaaggcgctgcaggtatgccaattgttcagaagcgcgaagatggtgtagaa
ctcaaacgcatcctcagcaacagcttcggttttggcggtactaacgcctgcctggtcttt
gaaaaatacgatcagtaa

DBGET integrated database retrieval system