KEGG   Klebsiella pneumoniae 342: KPK_0393Help
Entry
KPK_0393          CDS       T00772                                 

Gene name
tuf_1
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
kpe  Klebsiella pneumoniae 342
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kpe03012]
    KPK_0393 (tuf_1)
   03029 Mitochondrial biogenesis [BR:kpe03029]
    KPK_0393 (tuf_1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpe04147]
    KPK_0393 (tuf_1)
Translation factors [BR:kpe03012]
 Eukaryotic Type
  Elongation factors
   KPK_0393 (tuf_1)
 Prokaryotic Type
   KPK_0393 (tuf_1)
Mitochondrial biogenesis [BR:kpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KPK_0393 (tuf_1)
Exosome [BR:kpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KPK_0393 (tuf_1)
  Exosomal proteins of breast cancer cells
   KPK_0393 (tuf_1)
  Exosomal proteins of colorectal cancer cells
   KPK_0393 (tuf_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ACI08948
UniProt: B5XN88
LinkDB All DBs
Position
427200..428384
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtcaacgttggtactatcggccac
gttgaccatggtaaaactaccctgactgctgccatcactaccgttctggctaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcaccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgtgaactgctgtctcag
tacgatttcccgggcgacgacactccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggccacctggatacctatatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtcggt
gaagaagttgaaatcgttggtatcaaagacaccgcgaaaaccacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcagcatcaag
ccgcacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggttatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgtagctaaagttctgggctaa

DBGET integrated database retrieval system