KEGG   Klebsiella variicola 342: KPK_1596
Entry
KPK_1596          CDS       T00772                                 

Gene name
pbpG
Definition
(GenBank) penicillin-binding protein 7
  KO
K07262  serine-type D-Ala-D-Ala endopeptidase (penicillin-binding protein 7) [EC:3.4.21.-]
Organism
kpe  Klebsiella variicola 342
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kpe01002]
    KPK_1596 (pbpG)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpe01011]
    KPK_1596 (pbpG)
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     KPK_1596 (pbpG)
Peptidases and inhibitors [BR:kpe01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   KPK_1596 (pbpG)
Peptidoglycan biosynthesis and degradation proteins [BR:kpe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   KPK_1596 (pbpG)
SSDB
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13
Other DBs
NCBI-ProteinID: ACI11590
UniProt: B5XP77
LinkDB
Position
1627355..1628305
AA seq 316 aa
MMPKFRVSLLSLTLLLAVPFAPQALAKTSAAVAASQPDIASGSAMIVDLATKKIIYASQP
DLVRPMASITKVMTAMVVLDAHLPMDEMLTVDISHTPEMKGIYSRVRLNSQISRRTMLLL
ALMSSENRAAASLAHHYPGGYDAFIRAMNAKAQALGMTHTRYVEPTGLSVHNVSTARDLT
KLLIASEQYPLIGQLSTTKEETATFAHPAYSLPFRNTNHLVYRDNWNIQLTKTGFTNAAG
HCLIMRTVINQRPVALVVMDAFGKYTHFADASRLRTWIETGKVMPVPASALSYKKQREAQ
MAEAMLKGGAQTAQND
NT seq 951 nt   +upstreamnt  +downstreamnt
atgatgccgaaatttcgagtctctttgctcagcctgaccttgctgctggctgtgcctttt
gcgccccaggcgttagcaaaaacctccgcggcggttgccgcctcgcagccggatatcgcc
tccggcagcgccatgatcgtcgatctggccaccaaaaaaatcatctatgccagccagccg
gatctggtgcgcccgatggcgtcaatcaccaaagtgatgaccgccatggtggtgctcgat
gcccatctgccgatggatgagatgctgacggtggatatcagccatacgccggaaatgaag
gggatctactcccgcgtgcgcctcaacagccaaatcagccgccgcacgatgctgctgctg
gcgctgatgtcttccgagaaccgcgcggccgccagcctggcgcatcactatccaggcggc
tacgatgccttcattcgcgcgatgaacgccaaagcccaggcgctgggcatgactcatacc
cgctacgtggagccgacgggcctgtcggtgcataacgtctccaccgcccgcgatctgacc
aaactgctgatcgccagcgagcagtatccgctgatcggtcagctgagcaccaccaaagaa
gagaccgccactttcgctcatccggcctacagcctgccgttccgcaacaccaatcatctg
gtgtatcgcgataactggaatatccagctgactaaaaccggcttcaccaacgctgccggc
cactgcctgattatgcgtacggtgattaaccaacgcccggtggcgctggtggtgatggat
gccttcggtaaatacacccacttcgccgacgccagccgcttgcggacctggattgaaacc
gggaaggtgatgccggtacccgcctcggcgctgagctataaaaagcagcgcgaagcgcag
atggcggaggcgatgctgaaaggcggcgcgcagaccgcgcagaacgattaa

DBGET integrated database retrieval system