KEGG   Klebsiella pneumoniae 342: KPK_2353Help
Entry
KPK_2353          CDS       T00772                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kpe  Klebsiella pneumoniae 342
Brite
Enzymes [BR:kpe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KPK_2353 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACI09001
UniProt: B5XWM0
LinkDB All DBs
Position
complement(2413684..2414265)
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQAYVTNLNNLIKGTAFEGKSLEEIVRTS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPEGELAAAIAKSFGSFADFKAKFTDAAAKNFG
AGWTWLVKNADGSLAIVSTSNAGTPLTTDAKPLLTVDVWEHAYYIDYRNARPSYLDHFWA
LVNWKFVAANLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgaattacctgcattaccatatgcaaaagacgccctggcgccgcacatttcc
gcagaaaccctggaatatcactacggtaaacaccaccaggcgtatgtcactaacctcaac
aacctgatcaaaggcactgcgttcgaaggcaaatctctcgaagagatcgtccgcacttct
gaaggcggcgtattcaacaacgcagcccaggtctggaaccacaccttctactggaactgc
ctggcgccgaacgccggcggcgaaccggaaggcgagttagcggccgcgattgccaaatcc
ttcggcagctttgcggattttaaagccaaatttaccgatgccgcagcgaaaaacttcggc
gcgggctggacctggctggtcaaaaatgccgacggcagcctggctatcgtctccaccagc
aacgccggtaccccgctgaccaccgacgcgaagccgctgctgaccgttgacgtctgggaa
cacgcctactacatcgactaccgcaatgcccgtccaagctacctggaccatttctgggcg
ctggttaactggaagtttgttgcggccaacctggcggcataa

DBGET integrated database retrieval system