KEGG   Klebsiella variicola 342: KPK_3067
Entry
KPK_3067          CDS       T00772                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
kpe  Klebsiella variicola 342
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpe02044]
    KPK_3067
Secretion system [BR:kpe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPK_3067
SSDB
Motif
Pfam: T6SS_VasE CortBP2 Glutaredoxin2_C
Other DBs
NCBI-ProteinID: ACI11701
UniProt: B5XRR9
LinkDB
Position
complement(3121988..3123331)
AA seq 447 aa
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARIGLNHPWGVVEATFEPEMLKLGRL
QAHRLQVRFQDGTMIDTDNADALPSALSLDGADGEAVIVLALPLMQANGGNCLKPEEVAE
RPVRFRQRWRDVRNQFGEDTRQIAVMQPELTLRFAHQDNSDYLTCPLVRLQRDSQGAWLI
DETFLPPLLQIQGSRWLATQLEQLLTQLRARLTRLMAMRRESNERMADFAVADVSLFWLL
NALNSAEPVLGYFLRDQQSPPERLYPELARLAGSLLTFSLTHQANAVPIYQHDHLNAVFP
PLFDLLSDLLEASLPSRVVAIALEHDARLHFWQARLHDARLREGADYYLSVRSSVPVARL
QEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgatgaaaacggaacgtccgttgtggggccggggcattatggtgtcgccccagcatttt
caacagcaggctgcgtatgcagcctggactgcggaagtgattgcccggataggtcttaac
catccatggggagtggttgaggcgaccttcgaaccagagatgcttaaactgggccgcctg
caggctcacaggctgcaggtccggttccaggatggcacgatgattgatacggacaatgcc
gatgcgctgccgtccgcgctgtcactggacggcgcggacggcgaggcggtgatcgtgctg
gcgctgcccctgatgcaggcgaatggcggcaactgcctgaagccggaggaggtggccgaa
aggccggtgcgcttccggcagcgctggcgcgatgtccgcaaccagttcggggaagatacc
cgacagattgccgtcatgcagccggagctgaccctccgtttcgcccatcaggacaacagc
gattacctgacctgtccgcttgttcgcctgcagcgtgactcgcagggggcctggcttatc
gacgagacgtttctcccgccgctgctgcagatccagggcagccgctggctggcgacgcag
cttgaacagctgctcacccagcttcgggctcgtctgacgcgcctgatggccatgcgtcgc
gagagtaatgaacggatggctgattttgccgtggccgatgtctctctgttctggttgctg
aacgcgctgaacagcgccgagccggtgctggggtactttctgcgtgaccaacagagcccg
ccggaacgcctctatccggagctggcgcgcctggctggcagcctgctgaccttttcgctt
acccatcaggcgaatgccgtcccgatctatcagcatgaccatctgaacgcggtttttccg
ccgctgtttgatttactgagcgacctgctggaggcgagcctgccgtcgcgggtggtggcg
attgcgctggagcatgatgcccggctgcatttctggcaggcgcgcctgcacgatgcccgg
ctgcgggaaggggctgattactacctgtcggttcgttcgtcggtaccggtcgcccggctg
caggagcagtttccgcgacagtgcaaagtgggcagtccggatcatgtcaaagccattgtc
aactcctcgcggacaggggtgcccctgacgccattgcgtcatgtgccggcggcgatcccg
ctacgtctggaaaatcagtatttcagcctcgatgtgtcccaccctctggcgacggaaatg
ctgcagagcggcacctgtatgttctacgtcccggggatgctcggtgagcctgaacttgaa
ctttttgcggtactacgaacgtga

DBGET integrated database retrieval system