KEGG   Klebsiella pneumoniae 342: KPK_4540Help
Entry
KPK_4540          CDS       T00772                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00061  Fatty acid biosynthesis
kpe00780  Biotin metabolism
kpe01100  Metabolic pathways
kpe01212  Fatty acid metabolism
Module
kpe_M00083  Fatty acid biosynthesis, elongation
kpe_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KPK_4540 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KPK_4540 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpe01004]
    KPK_4540 (fabZ)
Enzymes [BR:kpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KPK_4540 (fabZ)
Lipid biosynthesis proteins [BR:kpe01004]
 Fatty acid synthase
  Component type
   KPK_4540 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ACI07478
UniProt: B5Y1J1
LinkDB All DBs
Position
complement(4567801..4568256)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcacattgaagagattctggaacttctgcctcaccgt
tacccgttcctgctggtagaccgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtttctgtaaacgagccgtttttccaggggcacttccctggtaagccgatt
ttgcctggcgtgctgattctggaagcgatggcgcaggccaccgggattctggcatttaaa
agcgtcggaaaactggagccaggcgagctgtattatttcgcaggcatcgacgaagcgcgc
ttcaaacgtccggtagtaccaggcgatcagatgattatggaagtcactttcgagaaaacc
cgccgcggcctgacccgtttcaaaggcgtcgcgctggttgacggtaaagtggtttgcgaa
gcgacgatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system