KEGG   Klebsiella pneumoniae 342: KPK_5205Help
Entry
KPK_5205          CDS       T00772                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPK_5205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpe02000]
    KPK_5205
Enzymes [BR:kpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KPK_5205
Transporters [BR:kpe02000]
 Other Transporters
  Pores ion channels [TC:1]
   KPK_5205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ACI11623
UniProt: B5XXU9
LinkDB All DBs
Position
complement(5260436..5261104)
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRVLWALEELQLPYQIVRYQREKSMLAPAALKKVHPLGKSPVLEDNGY
VLAESGAILEYLQETWDSGGLLKPQAIEDKLQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PVPFGVRSLGALLGKGIQKAWLDPQLATHARFIDDHLATRPWFAGERLSMADIQMSFPVM
ALLARGGVHDLVHIEAWRQRVEQRPAWQRAIERGGPFSLPGA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtacaccatcttaatcaatcacgatcgcaacgcgtactgtgggcactggaa
gagctgcagctgccttatcagatagtccgctatcagcgggaaaagtcgatgctggcgccg
gcggcgctgaagaaagtccatccgttggggaaatcgccggtgctggaagacaacggctat
gtgctggcggagtccggggccattctcgagtatttgcaggagacctgggacagcggcggg
ctgctgaagccgcaggcgatagaggacaaactgcagtaccgcttctggctgcactatgcc
gaaggctcgctgatgccgctgctgttaatgaagctggtgttcgccagcctgggtaaaccc
cctgtgccctttggcgtccgctctctgggcgccctgctgggcaagggcattcagaaagcg
tggctggatccccagctggccacccatgcgcggtttattgacgaccatcttgccacgcgg
ccatggtttgccggcgagcgtctaagtatggccgatatccagatgagcttcccggtgatg
gcgctgttggcgcgcggtggcgtgcatgaccttgtccatatcgaggcctggcgacagcgg
gtggagcagcgtccggcctggcagcgggccatcgagcgcggcggccccttttccttaccc
ggcgcctga

DBGET integrated database retrieval system