KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_04870Help
Entry
KPNIH32_04870     CDS       T03468                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00061  Fatty acid biosynthesis
kpg00780  Biotin metabolism
kpg01100  Metabolic pathways
kpg01212  Fatty acid metabolism
Module
kpg_M00083  Fatty acid biosynthesis, elongation
kpg_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:kpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KPNIH32_04870
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KPNIH32_04870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kpg01004]
    KPNIH32_04870
Enzymes [BR:kpg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KPNIH32_04870
Lipid biosynthesis proteins [BR:kpg01004]
 Fatty acid synthase
  Component type
   KPNIH32_04870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AIW75060
UniProt: A0A2X3GQR1
LinkDB All DBs
Position
983323..983778
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcacattgaagagattctggaacttctgcctcaccgt
tacccgttcctgctggtagaccgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtttctgtaaacgagccgtttttccaggggcacttccctggtaagccgatt
ttgccgggcgtcctgattctggaagcaatggcgcaagccaccgggattctggcgttcaaa
agcgtcggaaaactggaaccaggcgagctgtactacttcgcgggtatcgatgaagcacgc
ttcaaacgcccggtagtaccaggcgatcagatgattatggaagtcactttcgagaaaacc
cgccgcggcctgacccgtttcaaaggcgttgcgctggttgacggtaaagtggtttgcgaa
gcgacgatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system