KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_05260Help
Entry
KPNIH32_05260     CDS       T03468                                 

Definition
(GenBank) diaminohydroxyphosphoribosylaminopyrimidine deaminase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00010  Glycolysis / Gluconeogenesis
kpg00020  Citrate cycle (TCA cycle)
kpg00620  Pyruvate metabolism
kpg01100  Metabolic pathways
kpg01110  Biosynthesis of secondary metabolites
kpg01120  Microbial metabolism in diverse environments
kpg01130  Biosynthesis of antibiotics
kpg01200  Carbon metabolism
Module
kpg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH32_05260
   00020 Citrate cycle (TCA cycle)
    KPNIH32_05260
   00620 Pyruvate metabolism
    KPNIH32_05260
Enzymes [BR:kpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KPNIH32_05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl SLD3
Motif
Other DBs
NCBI-ProteinID: AIW75128
UniProt: A0A3N0N5U1
LinkDB All DBs
Position
complement(1058611..1060146)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDDFTRGQEICEIETSKIVNVLEAPFAGTLRR
ILAREGETLQVGAVLALAADASVSDAELDEFVARLATAKPAAPGPEAAAPDVAAQAGAKP
ASVVSPPSNSPEPPVGQTVIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGD
RISVSDLESAIVAAGGRLASPTPPVRRSKAPRSHADDSQVSATPLARRLAGKLGINLHDC
RSSGSRGRVSRDDVLAAALLLDEHPQTSPVQESAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLSVDLDLERLLALRQDINREVPGVKISVNDLLVKACALALVAVPDVNIQFDEAAQ
SIRRFTDADISVAVALPAGLITPIVRSANRKSISDISNEIHSLVTRAKAGTLKPEEFQGG
TFSLSNLGMLGVRQFDAIINPPQSAILAIGAGEVRAVVRDGQIVARQQMTVSLSCDHRVI
DGAAGAAFLRELKRLIETPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcgatgggcaatccaggagggtgacgatttcaccagagggcaggaaatatgtgag
attgaaaccagtaaaatcgtcaatgtgctggaggccccctttgccggtacgttacgtcgg
atactcgcccgcgagggtgagacgcttcaggtaggcgccgtgctggccctggcggctgac
gcgtcggtcagcgatgctgaactggacgaatttgttgcccgcctggcgacggcgaaaccc
gcagccccaggcccggaggctgccgcgccggacgtagcggcacaggcaggcgctaagcca
gcttccgttgtttcgccgccatccaacagccccgagccccctgttgggcagaccgtcatc
cccgtcagtctgcaaggtgtgaccgatgtgactcaggttaatgccacgccccatgcgtta
cgactgtctgcccgctggggtgtcgacctgaaaaaagtccgcggcagcgggcgcggggat
cgtatctctgtttctgatctggaaagcgcgatcgttgccgccggcggtcgcctggcctct
ccgacgccccccgttcgtcgcagcaaagcgccccgctcgcatgccgatgacagccaggta
tcggccaccccgctggcgcgccgcctggccggcaaactgggtatcaacttgcatgactgc
cgaagcagcggttcacgcggtcgggtaagtcgcgatgatgtgctggccgcggcgttgtta
ctcgacgagcacccgcagaccagtcctgtgcaggagagtgccccggccccctttgagagc
atcccgatgtccggtatgcggcgggctatcgcttctcgcctgcaaacgtccaagcaacag
tctccccatttccgtttgagcgtcgatctcgatctggagcgactgttagcgttacgtcag
gacattaaccgcgaagtacccggcgtcaagatttcggtgaatgacctgctggtgaaggcc
tgcgccctggcgctggtggccgtgcctgacgtcaatatccagtttgatgaagcggcacaa
agtatccgccgctttacggatgccgacatttcggtggccgttgcgctgcctgccgggcta
attacccctattgttcgctcggcgaaccggaaatcgattagcgacatatcgaacgaaatt
cactcgctggtgaccagagccaaagcgggcacgctgaagccggaagagttccagggcggg
acctttagcctgtcaaatctggggatgctcggcgtccggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcgccggcgaggtccgggcggtagtacgcgac
gggcaaatcgtcgcgcgacagcaaatgacggtatcgctatcctgcgatcaccgggtcatc
gatggcgcggcaggtgcggcttttctccgggaactcaagcgactgattgaaaccccgacc
ttgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system