KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_05610Help
Entry
KPNIH32_05610     CDS       T03468                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00730  Thiamine metabolism
kpg00790  Folate biosynthesis
kpg01100  Metabolic pathways
kpg02020  Two-component system
Module
kpg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KPNIH32_05610
   00790 Folate biosynthesis
    KPNIH32_05610
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KPNIH32_05610
Enzymes [BR:kpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KPNIH32_05610
Exosome [BR:kpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH32_05610
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpg00537]
 Enzymes
  KPNIH32_05610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AIW75195
LinkDB All DBs
Position
1126321..1127751
Genome map
AA seq 476 aa AA seqDB search
MEMTKVKLSALFIALIPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEAL
RASLINKPAKNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
TATAGEWQGKTLREQAQARGYQIVTDAASLAAATEASQDKPLLGLFADGNMPVRWEGPKA
SYHGNIDKPPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTH
DGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFTTMKAALSLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagatgacaaaagtgaaattaagcgccctgtttattgccctgattcctctactgggc
tcgccggttattcatgcagaaactactgctgcgccggttctggaaaatcgcgctgcgcag
ggagatatcaccactcctggcggcgcgcgtcgtttaacaggcgatcaaaccgaagcgctg
cgcgcctcgttaatcaataagccagctaaaaacgttattttgctgattggcgatggcatg
ggtgattcggaaattaccgctgcgcgaaactatgccgagggggcgggcggtttctttaaa
ggaattgatgctctgccgttaaccgggcagtacacgcattattcgctggataaaaaaacc
gggaaaccggactacgtgaccgactcggcggcctccgccaccgcctggaccaccggcgtg
aagacttataacggcgcgctgggcgtcgatattcatgagaatgcgcatcagaccatcctc
gagctggcgaaagcggcggggctggccaccggcaacgtttccaccgccgagctgcaggac
gccacccccgcggcgttggtagcgcatgtgacatcgcgtaaatgctacggcccgacggtc
accagcgaaaaatgccccagcaatgcgctggaaaaagggggcaaaggctccattaccgaa
cagctgctgaacgcccgaccggatgtcaccctgggcggcggcgcgaagacctttgccgaa
acggcgacggcgggcgagtggcagggcaaaaccctgcgcgagcaggcgcaagcgcgcggc
taccagattgtgaccgacgcggcttctcttgccgccgcgacggaagccagtcaggataaa
ccgctgctgggactctttgccgatggcaatatgccggtacgctgggaagggccgaaggcg
tcttatcacggtaatatcgataagccgccggtgacctgtacgccaaacccgaagcgtgac
gcctcggtgccgacgctggcgcaaatgacggagaaagcgattgacctgctgagtcgcaac
gagaaaggtttcttcctgcaagtcgaaggcgcttccatcgataagcaggaccatgcggcc
aatccgtgcggccagatcggcgaaacggttgatcttgacgaagcggtgcagaaggcgctg
gaattcgcgcgaaaagacggtaataccctggtgatcgtcaccgccgaccatgcgcatgcc
agccagatcatcccggcggatagcaaagccccggggctgacccaggctctgaacacgcac
gatggcgcggtgatggtgatgagctacggcaactctgaggaagagtcgatggagcacacc
ggcacccaactgcgcattgcggcctacggtccgcatgcggctaacgtcgtcggcctgacc
gatcagaccgacctgttcacgaccatgaaagctgccctgagtctcaaataa

DBGET integrated database retrieval system