KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_10760Help
Entry
KPNIH32_10760     CDS       T03468                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 ThiF
Motif
Other DBs
NCBI-ProteinID: AIW76168
UniProt: A0A3N0LIP8
LinkDB All DBs
Position
2146419..2147462
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILKTPGTMKIIAADIPVPKEHEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMGTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATDIAVVDVLEKRLAMAGKLGATTVINGAKEDTVARCQQFSGDIGADI
VFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYEDVQRAFDESVNNKREIIKGVIKVNH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaaccccgggtacgatgaaaattattgccgccgat
atcccggtacccaaagagcatgaagtgctgatcaaagttgaatacgttggtatttgcggt
tcagatgttcacgggtttgaatcgggcccttttattccgccgaaagacccaaaccaggaa
attggtctcgggcatgaatgtgccggtacggtggtggcggtgggaagtcgcgtcagtaaa
tttaaaccgggcgaccgggtgaacattgaacccggcgtgccgtgcggccactgccgctac
tgtctggaggggaaatacaacatctgccctgatgtcgactttatggccacgcagcctaac
tatcgcggcgcgctaacccactatctatgccatccggaaagcttcacttacaagctaccc
gataacatgggcaccatggaaggcgcgctggtagagcctgcggcggtagggatgcatgcc
gcaatgctggctgacgtgaagcctggcaagaaaatcgtcatcctgggggccggctgtatt
ggcttaatgaccctgcaagcctgtaagtgtttaggggcaaccgacatcgccgttgtcgat
gttctggaaaagcgtctggccatggccgggaagcttggggcgacgaccgtcatcaacggt
gcgaaagaggacaccgtcgcccgctgtcagcaattctccggcgatatcggggcagacatt
gtttttgaaacggccggctcggcgatcaccgtgaagcaggctccgtatctggtgatgcgc
ggcgggaaaatcatgatcgttggtacggttcccggagattcggcgattaattttctcaaa
attaaccgtgaagtctcaattcagaccgttttccgctatgccaaccgctatccggtcacc
attgaagccatttcctccgggcgtttcgatgtcaagtcgatggtgacgcatatttatgat
tatgaagatgttcagcgcgcgtttgacgagtccgttaacaacaaacgcgaaattatcaaa
ggcgttattaaagttaaccattaa

DBGET integrated database retrieval system