KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH32: KPNIH32_24495
Entry
KPNIH32_24495     CDS       T03468                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kpg  Klebsiella pneumoniae subsp. pneumoniae KPNIH32
Pathway
kpg00052  Galactose metabolism
kpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH32_24495
Enzymes [BR:kpg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     KPNIH32_24495
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 TrkA_N Methyltransf_25 2-Hacid_dh_C Methyltransf_31 MTS UDPG_MGDP_dh_N 3HCDH_N Methyltransf_24 PrmA CoA_binding Methyltransf_11 Pyr_redox_2 ELFV_dehydrog Shikimate_DH Pyr_redox Met_10
Other DBs
NCBI-ProteinID: AIW78744
UniProt: A0A3N0PN66
LinkDB
Position
4892641..4893684
AA seq 347 aa
MKSVVIHAEGNVCVEERPIPTLQTENDVLVKVVSSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVESYGAAVTDLQPGDAVACVPLLPCFQCPQCQREYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPDQMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIIGAGTIGLLALQCA
RELGANSVTAIDINPQKLELAKTLGATHVFNSREMSGQAIQQALESIQFDQLVLETAGTP
QTVALAIEAAGPRAQLALVGTLHHDLTLLAATFGQILRKELNIVGSWMNYSGPWPGEEWQ
TATRLLTEKRLQLAPLIAHRGDAESFARAVQALNGAPMQGKILLKLS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaatccatgctgaggggaacgtctgcgttgaagaacgccctatcccc
acgctgcaaacggaaaacgatgtcctggtcaaagtggtcagttccgggttatgcggctcc
gatatcccgcgcattttcgccaaaggggcgcattactaccctattacgctggggcacgaa
ttcagcggttatgtggaatcctacggcgcggcggtaaccgacctgcagcccggcgatgcc
gtcgcctgcgtgccgctgctgccttgcttccagtgcccgcaatgccagcgcgagtatttc
tctttatgtaaacagtatcagttcgtcggctcacgcagcgaaggcggcaacgccgaatat
gtggtggtaaagcgcgccaacctgttccgcctgccggaccagatgccaattgatgatggc
gcgtttatcgaaccgataaccgttggcctgcacgcttttcatctggcgcagggctgtgaa
ggtaaaaacgtgattattatcggcgccggcaccatcggcctgctggcgctacagtgcgcc
cgcgaactgggcgccaacagcgtcacggcgatcgatatcaatccgcagaagctggagctg
gccaaaaccctcggcgcaacccatgtgttcaacagtcgcgagatgagcggccaggcgatt
cagcaggcgctggaatccattcagttcgaccagttagtcctcgagaccgccggtacgccg
cagaccgtcgcgctggcgattgaggccgccggtccgcgggcgcagctggcgttggttggc
acgcttcatcacgatttaaccctcctggcagccaccttcgggcagattctgcgtaaggag
ttgaatattgtgggtagctggatgaactactctggcccgtggccgggagaagagtggcaa
acggccacccgtctgctgactgaaaaacgcctgcagctggcgccgctgatcgcccatcgt
ggcgacgcagaaagcttcgctcgtgcagtgcaggcgctcaacggcgcgccaatgcaaggc
aaaatcctgctcaaactctcttga

DBGET integrated database retrieval system