KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_05510
Entry
KPNIH24_05510     CDS       T03369                                 

Definition
(GenBank) sugar kinase
  KO
K21621  tagatose kinase [EC:2.7.1.101]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00052  Galactose metabolism
kph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH24_05510
Enzymes [BR:kph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.101  tagatose kinase
     KPNIH24_05510
SSDB
Motif
Pfam: PfkB Phos_pyr_kin
Other DBs
NCBI-ProteinID: AID94695
LinkDB
Position
1150905..1151855
AA seq 316 aa
MNVTICTIGELLVEFLAKEENQGFSRPGEFWGPYPSGAPAIFADQVAKLGFGSVLFSCVG
NDAFGEMNIARLEKDGVNVNGIAMLQKATTGSAFVSYRSQAQRDFIFNMPNSACGLLTAD
HIDEALLNQCQHFHIMGSSLFSFRIIDAMRKAIENIKGRSGTVSFDPNIRKEMLNIPEMS
QAFEYILDYTDIFLPSDGELDYFGLNPERNEQVLVDKLLKRGVKHVVIKRGPRGASYFSA
NETHHVAGFSVPVVDPTGAGDCFGATFVSLFLNGATPREALRWANASGSLAISQRGPMEG
TSTQAEISAFLAAQHP
NT seq 951 nt   +upstreamnt  +downstreamnt
atgaacgtaaccatttgcaccatcggcgagctgctggtggagtttctcgccaaggaagag
aatcaggggttttcccgtcccggtgaattttgggggccctatcccagcggggcgccggca
atatttgccgatcaggtggcaaagctgggtttcggctccgtgttgtttagctgtgtgggc
aacgacgcatttggcgagatgaatattgcgcggctggagaaagacggcgtcaacgtcaac
ggcatcgctatgctgcagaaagcgactaccggtagcgccttcgtcagctatcgtagccag
gcgcagcgcgattttatttttaatatgcctaacagcgcctgcggtctgctgactgccgac
cacattgacgaagcgttgctaaatcagtgtcagcattttcatattatggggtcatcgcta
ttctcgttccgtattatcgatgcgatgcgtaaagcgattgaaaacattaaaggccgcagc
ggcacagtatcgttcgacccaaatattcgcaaagagatgctgaacatcccggagatgtcg
caggcctttgaatatattctcgactacaccgatatcttcctgccgagcgatggcgagctg
gattactttggtctcaatccggaacgcaatgagcaggtcctggttgataagctactgaaa
cgcggcgtgaagcatgtggtgattaaacgcgggccgcgtggcgcaagctactttagcgcc
aacgagacgcaccatgtcgccggcttcagcgtgccggtggtggatccgactggtgccggg
gattgctttggcgccacctttgttagtctgttcctcaatggcgccacgccccgggaggcg
ctgagatgggcaaacgccagcggctcgctggcgattagccaacgcggccccatggaaggc
acctcgacgcaggcggagatcagcgcttttcttgccgcccagcatccctaa

DBGET integrated database retrieval system