KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_09635
Entry
KPNIH24_09635     CDS       T03369                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00010  Glycolysis / Gluconeogenesis
kph00052  Galactose metabolism
kph00500  Starch and sucrose metabolism
kph00520  Amino sugar and nucleotide sugar metabolism
kph00521  Streptomycin biosynthesis
kph01100  Metabolic pathways
kph01110  Biosynthesis of secondary metabolites
kph01120  Microbial metabolism in diverse environments
kph01200  Carbon metabolism
Module
kph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kph_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
kph_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH24_09635 (glk)
   00052 Galactose metabolism
    KPNIH24_09635 (glk)
   00500 Starch and sucrose metabolism
    KPNIH24_09635 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    KPNIH24_09635 (glk)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KPNIH24_09635 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KPNIH24_09635 (glk)
Enzymes [BR:kph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KPNIH24_09635 (glk)
SSDB
Motif
Pfam: Glucokinase PaaX_C
Other DBs
NCBI-ProteinID: AID95479
LinkDB
Position
1986595..1987560
AA seq 321 aa
MTKFALVGDVGGTNARLALCDLASGEISRAKTYSGLDYPSLEAVVRVYLEEHQVTVNEGC
IAIACPITGDWVAMTNHTWAFSIAEMKRNLGFAHLEIINDFTAVSMAIPMLKAEHLIQFG
GSAPVAGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
LGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPREVTERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HDNPGLLGSGAHLRQTLGQVL
NT seq 966 nt   +upstreamnt  +downstreamnt
atgacaaaatttgctttagtaggagatgtcggggggaccaacgcccgcctggcgctatgt
gatctggcgagtggagagatctctcgcgcaaagacctattccgggctcgattaccccagt
ctggaggcagtggtgcgcgtctacctcgaggagcaccaggtaacggtcaacgaaggttgt
atcgccatcgcatgcccgattaccggcgactgggtggcgatgaccaaccatacctgggct
ttctctatcgccgaaatgaagcgcaacctcggctttgcccatctggagataattaacgat
tttaccgctgtttcaatggccattccgatgctgaaagctgagcaccttattcagtttggc
ggcagtgcgccggtagcgggcaaaccgatcgccgtttatggcgccgggaccgggctcggc
gtggcgcatctggtccacgttgataagcgttgggtcagcctgccgggcgaaggcggtcat
gttgattttgccccgaacagcgaagaagaagggatcattctggaagagctacgcgccgag
ctggggcatgtttccgcagaacgcgtgctctcaggtcccgggctggtcaacctgtatcgc
gcgattgtcaaatcggacggccgactgccggagaacctgcagccgcgtgaggtgaccgag
cgagcgctggcggacagctgcaccgactgtcgtcgggcgctgtcgctgttctgcgtcatt
atgggacgcttcggcggtaacctggcgctgaccctcgggacgtttggcggggtgtatatc
gccggcggcatcgtgccgcgcttcctggagttctttaaagcctctggtttccgcggcggt
tttgaagacaaaggccgttttaaagcttatgttcaggatatcccggtttacctgattgtg
catgataacccaggcctgctgggctccggtgcgcatctgcgtcagacgctgggccaggtg
ctttaa

DBGET integrated database retrieval system